Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040488 (Ltbp4)
Chromosomal location
Chr 7: 28090159 - 28122711 (-)
Description
latent transforming growth factor beta binding protein 4 Gene [Source:MGI (curated);Acc:Ltbp4-001]
RefSeq_dna
NM_175641 
RefSeq_peptide
NP_001107021.1 NP_783572.2 
UniGene
Mm.272251 
MGI
MGI:1321395 
Uniprot/SWISSPROT
Q8K4G1 
Uniprot/SPTREMBL
Q3UGU1 B2RU79 
Human Ortholog
ENSG00000090006 (LTBP4)
Omim not available
UniTrap UNI31843
Vector Insertion
Chr 7: 28120695 - 28122712
Public Clones IST14526G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24574
Vector Insertion
Chr 7: 28120555 - 28120671
Public Clones not available
Private Clones OST214499 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11249
Vector Insertion
Chr 7: 28118683 - 28119855
Public Clones G026A01 (ggtc) IST13042E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22426
Vector Insertion
Chr 7: 28115338 - 28118373
Public Clones (sanger) E031G08 (ggtc) E110D07 (ggtc) E099C04 (ggtc) IST13253E2 (tigm)
IST13309H1 (tigm) IST14559G11 (tigm) IST11937D11 (tigm) IST14654F9 (tigm)
IST12069C9 (tigm) IST13413A1 (tigm) IST13266E9 (tigm) IST14873G8 (tigm)
IST13200E10 (tigm) IST13250E4 (tigm) IST11863E1 (tigm) IST13504F9 (tigm)
IST14808E3 (tigm) IST12556E8 (tigm) IST13663C12 (tigm) IST13962A9 (tigm)
IST13290E10 (tigm) IST13413H12 (tigm) IST15031F3 (tigm) IST13334E1 (tigm)
IST13319F2 (tigm) IST11772H4 (tigm)
Private Clones OST297364 (lexicon) OST188225 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11239
Vector Insertion
Chr 7: 28114838 - 28115145
Public Clones G030C05 (ggtc) IST13979B3 (tigm) IST12769A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23644
Vector Insertion
Chr 7: 28114062 - 28114397
Public Clones not available
Private Clones OST250815 (lexicon) OST149364 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36327
Vector Insertion
Chr 7: 28113204 - 28113882
Public Clones IST14401C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32233
Vector Insertion
Chr 7: 28112656 - 28113370
Public Clones IST14401C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33544
Vector Insertion
Chr 7: 28112279 - 28112807
Public Clones IST14746F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11152
Vector Insertion
Chr 7: 28111843 - 28112279
Public Clones G056F12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32239
Vector Insertion
Chr 7: 28111505 - 28111843
Public Clones IST13063G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16474
Vector Insertion
Chr 7: 28110281 - 28110696
Public Clones not available
Private Clones OST460238 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1502
Vector Insertion
Chr 7: 28099403 - 28104429
Public Clones CC0769 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11232
Vector Insertion
Chr 7: 28096832 - 28099255
Public Clones G037H09 (ggtc) G032A04 (ggtc) G038H09 (ggtc) IST13751H5 (tigm) IST12557F11 (tigm)
IST12649D6 (tigm) IST15060E3 (tigm) IST14842A2 (tigm) IST10612C5 (tigm)
IST11094A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35715
Vector Insertion
Chr 7: 28095539 - 28096832
Public Clones (sanger) PST17342-NR (escells) PST22645-NR (escells) IST12555B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11251
Vector Insertion
Chr 7: 28095272 - 28095539
Public Clones G024G02 (ggtc) G020G10 (ggtc) IST10347D2 (tigm)
Private Clones OST53142 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17324
Vector Insertion
Chr 7: 28094434 - 28095199
Public Clones (sanger) IST12505C1 (tigm) IST13952B10 (tigm) IST10552H3 (tigm) IST13191G4 (tigm)
IST14305B8 (tigm) IST14337A7 (tigm) IST10873E10HMF2 (tigm) IST10480G11 (tigm)
IST14549D8 (tigm) IST12430C5 (tigm) IST13657G2 (tigm) IST10394A11HMF1 (tigm)
IST11258A6 (tigm)
Private Clones OST445176 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10748
Vector Insertion
Chr 7: 28094087 - 28094304
Public Clones G029B04 (ggtc) CMHD-GT_354G10-3 (cmhd) IST13899C6 (tigm) IST14882F4 (tigm)
IST14543H3 (tigm) IST10997C11 (tigm) IST15061G4 (tigm) IST11001C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11243
Vector Insertion
Chr 7: 28092940 - 28093939
Public Clones P131F01 (ggtc) D051G06 (ggtc) G029C04 (ggtc) Q014E05 (ggtc) (ggtc)
CMHD-GT_364D7-3 (cmhd) CMHD-GT_373B12-3 (cmhd) IST10111F1 (tigm)
Private Clones OST143290 (lexicon) OST135239 (lexicon) OST67822 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35650
Vector Insertion
Chr 7: 28091580 - 28092940
Public Clones (sanger) IST14580F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13716
Vector Insertion
Chr 7: 28091016 - 28091239
Public Clones CMHD-GT_267F3-3 (cmhd) CMHD-GT_267F4-3 (cmhd)
Private Clones OST437791 (lexicon) OST311473 (lexicon) OST308320 (lexicon) OST275711 (lexicon)
OST151139 (lexicon) OST56309 (lexicon) OST40577 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21265
Vector Insertion
Chr 7: 28090570 - 28091085
Public Clones CMHD-GT_444H8-3 (cmhd) CMHD-GT_409C1-3 (cmhd) IST14902G6 (tigm)
Private Clones OST336763 (lexicon) OST336561 (lexicon) OST199344 (lexicon) OST176066 (lexicon)
OST85730 (lexicon) OST2185 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118961
Sequence
GGGCGGGCTGGGGCGGCGGCGCGGTGGAGCGCGGCGCTGCAGCCATGGCGGGCGGCGCGCAGCTGCTCTGGGTGTCGCTATTGGTGCTGCTGGCGCAGCT

GGGGCCGCAGCCCGTACTGGGCCGACCCCGAGAGCGTCTTCGCGTGCGCTTCACCCCCGCTGTGTGCGGCCTGCGTTGCATCCACGGGCCCACTGGCTCC

CGCTGTACCCCGACCTGCGCGCCCCGCAACGCCACCAGCGTGGACAGCGGCGCGCCCGGCGGGGCGGCCCCGGGGGGACCCGGCTTCCGCGCCT - UNI

22426 - TCCTATGTCCCTTGATCTGTCACAACGGTGGTGTGTGTGTGAAGCCTGATCGCTGCCTTTGCCCCCCGGACTTCGCTGGCAAATTCTGCCAA

TTGCATTCTTCGGGGGCCCGGCCCCCGGCCCCAGCCATGCCGGGCCTTACCCGCTCCGTTTATACAATGCCACTAGCCAACCACCGCGATGATGAACACG

 - UNI11239 - GAGTAGCATCGATGGTGAGCGTGCACGTGGAGCACCCTCAGGAGGCATCAGTGGTGGTGCACCAAGTGGAACGTGTGTCGGGCCCC

TGGGAGGAGGCGAACCCTGAAGCCCTAGCCAGGGCTGAAGCGGCGGCACGGGCCGAGGCGGCGGCGCCCTACACAGTGCTGGCACAGAGCGCGCCACGCG

AGGACGGCTACTCAGACGCCTCCGGCTTCGGTTACTGTTTTAGAGAACTGCGCGGAAGCGAA TGTGCATCGCCGCTGCCAGGGCTCCGGACGCAGGAAG

TCTGCTGCCGAGGAGAGGGCTTGGCCTGGGGTGTTCATGATTGTCACCCGTGCGCGGAACACCTGA - UNI23644 - GGAACTCCAACCAAGTGAGT

GGCCCAAATGGACCTTGTCCACCCGGCTTCGAGAGAGTTAATGGGTCCTGTGTAG - UNI36327 - ATGTGGATGAGTGCGCCACCGGTGGGCGTTG

CCAACACGGGGAGTGTGCCAACACTCGTGGCGGCTACACGTGTGTATGTCCGGACGGTTTCCTCCTGGACTCTTCCCGCAGCAGCTGCATCT - UNI32

233 - - UNI36327 - CCCAACACGTGATCTCCGAGGCAAAGGGGCCCTGCTACCGAGTGCTGCATGATGGCGGATGCTCGCTGCCCATTCTTCGAA

ATATCACCAAACAGATCTGCTGCTGTAGCCGTGTGGGCAAGGCGTGGGGCCGAGGCTGCCAGCTCTGTCCACCTTATGGTTCAG - UNI32233 - - 

UNI33544 - - UNI36327 - AGGGTTTTCGGGAGATCTGTCCAGCTGGCCCTGGCTACCACTATTCAGCTTCTGACCTCCGATACAACACCAGACC

CCTAAACCAGGATCCACCTCGAGTGACCTTCAATCAGCCACGTGTTCCACCAGCCACCCCTCGGCCACCTACAG - UNI32233 - - UNI33544 -

 GCTTTCTGCCTACTCGTCGACCTGAGCCCCGCCCTGACCCTGGGCCACAGCCTGAACCCCGGCCTCGGCCTGAACCCCGGCCTCGGCCTGAATCCCGAC

CTCGGCCTGAACCCCGGCCTCGGCCTGAACCCCGGCCTCAGCCTGAATCCCAGCCTAGGCCTGAATCCCGGCCTCGGCCTGAATCCCAGCCTTGGCCTGA

ATTTCCCCTGCCCAGCATCCCTGCTTGGACCGGTCCAGAGATTCCTGAATCAG - UNI11152 - - UNI32239 - - UNI33544 - GTCCCTC

TTCCAGCATGTGTCAGCGAAATCCCCAGGTTTGTGGTCCTGGACGCTGCGTTCCTAGGCCAAGCGGCTACACTTGTGCGTGCGACCCAGGTTTCCGGCTC

GGCCCCCAGGGCACTCGCTGCATTG - UNI32239 - ACATAGATGAATGTCGCCGCGTCCCTACACCCTGTGCTCCTGGGCGTTGCGAGAATACACC

AGGCAGCTTTCGCTGCGTGTGCGGCACGGGCTTCCAAGCAGGCCCGCGGGCTACAGAGTGCCTGG - UNI32239 - ATGTGGACGAGTGCCGCCGCG

TGCCGCCGCCGTGTGACCGCGGGCGCTGCGAGAACACGCCAGGCAGTTTCCTATGTGTGTGTCCCGCCGGGTACCAGGCAGCACCGCACGGAGCCAGCTG

CCAGG - UNI16474 - ATGTGGATGAATGCACCCAGAGCCCAGGCCTCTGTGGTCGCGGGGTCTGCGAAAACCTGCCCGGCTCTTTCCGCTGTGTTT

GCCCGGCTGGCTTCCGGGGCTCGGCGTGTGAAGAAGATGTGGATGAATGTGCCCAGCAGCCTCCGCCTTGCGGGCCAGGCCGCTGCGACAACACCGCGGG

TTCGTTCCACTGTGCCTGCCCAGCTGGCTTCCGATCCCGAGGACCAGGAGCCCCCTGCCAAG ATGTGGATGAATGTTCCCGGAGCCCCTCGCCTTGTGC

CTATGGCCGCTGTGAGAACACGGAAGGCAGCTTCAAGTGTGTCTGCCCAACAGGCTTCCAACCCAACGCTGCGGGCTCCGAGTGCGAGG ATGTGGATGA

GTGTGAGAACCGCTTGGCGTGTCCAGGGCAGGAGTGTGTGAACTCACCGGGCTCCTTCCAGTGCCGGGCCTGCCCTGTTGGGCACCACCTGCACCGTGGC

AGATGTACTG ATGTGGATGAATGCAGTTCGGGCACCCCTTGTGGTCTCCATGGCCAGTGCACAAATACTAAAGGCTCCTTCCACTGCAGCTGCTCGACA

GGTTACCGGGCGCCATCTGGTCAACCTGGGCCTTGTGCAG ACATAAATGAGTGTCTGGAAGGCGACTTCTGCTTCCCCCACGGAGAGTGCCTCAACACT

GATGGCTCCTTTACCTGTACCTGTGCCCCTGGCTACCGGCCTGGACCTCGTGGAGCATCTTGTCTGG ACGTGGACGAGTGCAGCGAAGAGGATCTTTGC

CAGAGCGGCATCTGTACCAACACTGACGGCTCCTTCGAGTGCATCTGTCCTCCTGGACACCGCGCTGGCCCTGACCTTGCCTCCTGCCTTG ACATTGAC

GAGTGTCGTGAACGGGGACCTGCCCTGTGCGGGTCTCAGCGCTGTGAAAATTCTCCTGGTTCCTACCGCTGTGTGCGGGACTGCGATCCAGGTTACCACC

CCGGCCCTGAGGGCACCTGTGATG ACATTGATGAGTGCCGAGAATACGGCTCTGCGATTTGTGGTGCCCAGCGCTGTGAGAACACCCCGGGCTCCTACC

GCTGCACACCAGCCTGCGACCCTGGCTATCAGCCTACACCAGGGGGCGGGTGCCAAG ATGTGGATGAATGCCGGAACCGGTCTTTCTGCGGCGCCCATG

CTATGTGCCAGAATCTGCCTGGGTCCTTTCAGTGCGTCTGTGACCAAGGCTACGAAGGGGCACGGGACGGACGTCACTGCGTGG - UNI1502 - ATG

TGAATGAGTGTGAGACACTACAGGGCGTGTGTGGCTCCGCGCTGTGTGAAAATGTTGAAGGCTCCTTCCTGTGTGTCTGCCCCAATAGCCCTGAGGAATT

TGATCCCATGACTGGACGCTGTGTTCCCCCACGGGCTCCTGCAG - UNI11232 - - UNI35715 - GAGGTTGGACTTCTCAGGGCACGGAGCAC

CATGGACCGGTTTCAATCCAGAAAGAGTTTGGAATCTCCCTGGGGATGCTGTGTGAAAGTGTTGAGTGAAAGTGTTGAAGCAGAGAGGACAAAGTTGGAC

CAAACCAGGGGTCTTGAGTGGGGAGGGGCAGTGTAACCTCAAGCTTTTACACACGTGCCCCTATTCCCAAAATAATGACTCTGAGACTTATTTATTTATG

AATAAATGTCATAAGTGTTGACTC
Translation
MAGGAQLLWVSLLVLLAQLGPQPVLGRPRERLRVRFTPAVCGLRCIHGPTGSRCTPTCAPRNATSVDSGAPGGAAPGGPGFRAF - UNI22426 - FL

CPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAMPGLTRSVYTMPLANHRDDEHG - UNI11239 - GVASMVSVHVEHPQEASVVVHQV

ERVSGPWEEANPEALARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGSE CASPLPGLRTQEVCCRGEGLAWGVHDCHPCAEHLR - U

NI23644 - RNSNQVSGPNGPCPPGFERVNGSCVD - UNI36327 - DVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCIS - UNI32

233 - - UNI36327 - SQHVISEAKGPCYRVLHDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPYGSE - UNI32233 - - UNI33544 

- - UNI36327 - EGFREICPAGPGYHYSASDLRYNTRPLNQDPPRVTFNQPRVPPATPRPPTG - UNI32233 - - UNI33544 - GFLPTRR

PEPRPDPGPQPEPRPRPEPRPRPESRPRPEPRPRPEPRPQPESQPRPESRPRPESQPWPEFPLPSIPAWTGPEIPESG - UNI11152 - - UNI322

39 - - UNI33544 - GPSSSMCQRNPQVCGPGRCVPRPSGYTCACDPGFRLGPQGTRCID - UNI32239 - DIDECRRVPTPCAPGRCENTPGS

FRCVCGTGFQAGPRATECLD - UNI32239 - DVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQD - UNI16474 - DVDECTQSP

GLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQD DVDECSRSPSPCAYGRCENTEGSFKC

VCPTGFQPNAAGSECED DVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTD DVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPG

PCAD DINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLD DVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLD DIDECRER

GPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDD DIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQD DVDECRNRSFCGAHAM

CQNLPGSFQCVCDQGYEGARDGRHCVD - UNI1502 - DVNECETLQGVCGSALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRAPAG - UNI1123

2 - - UNI35715 - GGWTSQGTEHHGPVSIQKEFGISLGMLCESVE
Transcript ENSMUST00000118583
Sequence
GCTGCAGCCATGGCGGGCGGCGCGCAGCTGCTCTGGGTGTCGCTATTGGTGCTGCTGGCGCAGCTGGGGCCGCAGCCCGTACTGGGCCGACCCCGAGAGC

GTCTTCGCGTGCGCTTCACCCCCGCTGTGTGCGGCCTGCGTTGCATCCACGGGCCCACTGGCTCCCGCTGTACCCCGACCTGCGCGCCCCGCAACGCCAC

CAGCGTGGACAGCGGCGCGCCCGGCGGGGCGGCCCCGGGGGGACCCGGCTTCCGCGCCT - UNI22426 - TCCTATGTCCCTTGATCTGTCACAACG

GTGGTGTGTGTGTGAAGCCTGATCGCTGCCTTTGCCCCCCGGACTTCGCTGGCAAATTCTGCCAATTGCATTCTTCGGGGGCCCGGCCCCCGGCCCCAGC

CATGCCGGGCCTTACCCGCTCCGTTTATACAATGCCACTAGCCAACCACCGCGATGATGAACACG - UNI11239 - GAGTAGCATCGATGGTGAGCG

TGCACGTGGAGCACCCTCAGGAGGCATCAGTGGTGGTGCACCAAGTGGAACGTGTGTCGGGCCCCTGGGAGGAGGCGAACCCTGAAGCCCTAGCCAGGGC

TGAAGCGGCGGCACGGGCCGAGGCGGCGGCGCCCTACACAGTGCTGGCACAGAGCGCGCCACGCGAGGACGGCTACTCAGACGCCTCCGGCTTCGGTTAC

TGTTTTAGAGAACTGCGCGGAAGCGAA TGTGCATCGCCGCTGCCAGGGCTCCGGACGCAGGAAGTCTGCTGCCGAGGAGAGGGCTTGGCCTGGGGTGTT

CATGATTGTCACCCGTGCGCGGAACACCTGA - UNI23644 - GGAACTCCAACCAAGTGAGTGGCCCAAATGGACCTTGTCCACCCGGCTTCGAGAG

AGTTAATGGGTCCTGTGTAG - UNI36327 - ATGTGGATGAGTGCGCCACCGGTGGGCGTTGCCAACACGGGGAGTGTGCCAACACTCGTGGCGGCT

ACACGTGTGTATGTCCGGACGGTTTCCTCCTGGACTCTTCCCGCAGCAGCTGCATCT - UNI32233 - - UNI36327 - CCCAACACGTGATCTC

CGAGGCAAAGGGGCCCTGCTACCGAGTGCTGCATGATGGCGGATGCTCGCTGCCCATTCTTCGAAATATCACCAAACAGATCTGCTGCTGTAGCCGTGTG

GGCAAGGCGTGGGGCCGAGGCTGCCAGCTCTGTCCACCTTATGGTTCAG - UNI32233 - - UNI33544 - - UNI36327 - AGGGTTTTCGG

GAGATCTGTCCAGCTGGCCCTGGCTACCACTATTCAGCTTCTGACCTCCGATACAACACCAGACCCCTAAACCAGGATCCACCTCGAGTGACCTTCAATC

AGCCACGTGTTCCACCAGCCACCCCTCGGCCACCTACAG - UNI32233 - - UNI33544 - GCTTTCTGCCTACTCGTCGACCTGAGCCCCGCCC

TGACCCTGGGCCACAGCCTGAACCCCGGCCTCGGCCTGAACCCCGGCCTCGGCCTGAATCCCGACCTCGGCCTGAACCCCGGCCTCGGCCTGAACCCCGG

CCTCAGCCTGAATCCCAGCCTAGGCCTGAATCCCGGCCTCGGCCTGAATCCCAGCCTTGGCCTGAATTTCCCCTGCCCAGCATCCCTGCTTGGACCGGTC

CAGAGATTCCTGAATCAG - UNI11152 - - UNI32239 - - UNI33544 - GTCCCTCTTCCAGCATGTGTCAGCGAAATCCCCAGGTTTGTG

GTCCTGGACGCTGCGTTCCTAGGCCAAGCGGCTACACTTGTGCGTGCGACCCAGGTTTCCGGCTCGGCCCCCAGGGCACTCGCTGCATTG - UNI3223

9 - ACATAGATGAATGTCGCCGCGTCCCTACACCCTGTGCTCCTGGGCGTTGCGAGAATACACCAGGCAGCTTTCGCTGCGTGTGCGGCACGGGCTTCC

AAGCAGGCCCGCGGGCTACAGAGTGCCTGG - UNI32239 - ATGTGGACGAGTGCCGCCGCGTGCCGCCGCCGTGTGACCGCGGGCGCTGCGAGAAC

ACGCCAGGCAGTTTCCTATGTGTGTGTCCCGCCGGGTACCAGGCAGCACCGCACGGAGCCAGCTGCCAGG - UNI16474 - ATGTGGATGAATGCAC

CCAGAGCCCAGGCCTCTGTGGTCGCGGGGTCTGCGAAAACCTGCCCGGCTCTTTCCGCTGTGTTTGCCCGGCTGGCTTCCGGGGCTCGGCGTGTGAAGAA

GATGTGGATGAATGTGCCCAGCAGCCTCCGCCTTGCGGGCCAGGCCGCTGCGACAACACCGCGGGTTCGTTCCACTGTGCCTGCCCAGCTGGCTTCCGAT

CCCGAGGACCAGGAGCCCCCTGCCAAG ATGTGGATGAATGTTCCCGGAGCCCCTCGCCTTGTGCCTATGGCCGCTGTGAGAACACGGAAGGCAGCTTCA

AGTGTGTCTGCCCAACAGGCTTCCAACCCAACGCTGCGGGCTCCGAGTGCGAGG ATGTGGATGAGTGTGAGAACCGCTTGGCGTGTCCAGGGCAGGAGT

GTGTGAACTCACCGGGCTCCTTCCAGTGCCGGGCCTGCCCTGTTGGGCACCACCTGCACCGTGGCAGATGTACTG ATGTGGATGAATGCAGTTCGGGCA

CCCCTTGTGGTCTCCATGGCCAGTGCACAAATACTAAAGGCTCCTTCCACTGCAGCTGCTCGACAGGTTACCGGGCGCCATCTGGTCAACCTGGGCCTTG

TGCAG ACATAAATGAGTGTCTGGAAGGCGACTTCTGCTTCCCCCACGGAGAGTGCCTCAACACTGATGGCTCCTTTACCTGTACCTGTGCCCCTGGCTA

CCGGCCTGGACCTCGTGGAGCATCTTGTCTGG ACGTGGACGAGTGCAGCGAAGAGGATCTTTGCCAGAGCGGCATCTGTACCAACACTGACGGCTCCTT

CGAGTGCATCTGTCCTCCTGGACACCGCGCTGGCCCTGACCTTGCCTCCTGCCTTG ACATTGACGAGTGTCGTGAACGGGGACCTGCCCTGTGCGGGTC

TCAGCGCTGTGAAAATTCTCCTGGTTCCTACCGCTGTGTGCGGGACTGCGATCCAGGTTACCACCCCGGCCCTGAGGGCACCTGTGATG ACATTGATGA

GTGCCGAGAATACGGCTCTGCGATTTGTGGTGCCCAGCGCTGTGAGAACACCCCGGGCTCCTACCGCTGCACACCAGCCTGCGACCCTGGCTATCAGCCT

ACACCAGGGGGCGGGTGCCAAG ATGTGGATGAATGCCGGAACCGGTCTTTCTGCGGCGCCCATGCTATGTGCCAGAATCTGCCTGGGTCCTTTCAGTGC

GTCTGTGACCAAGGCTACGAAGGGGCACGGGACGGACGTCACTGCGTGG - UNI1502 - ATGTGAATGAGTGTGAGACACTACAGGGCGTGTGTGGC

TCCGCGCTGTGTGAAAATGTTGAAGGCTCCTTCCTGTGTGTCTGCCCCAATAGCCCTGAGGAATTTGATCCCATGACTGGACGCTGTGTTCCCCCACGGG

CTCCTGCAG - UNI11232 - - UNI35715 - GCACGTTCCCTGGCTCCCAGCCCCAAGCACCTGCCAGCCCCAGTCTTCCAGCCAGGCCACCAGC

CCCTCCCCCACCTCGAAGACCCAGCCCTCCCAGGCAGGGTCCCGTGAGCAGTGGACGTCGCGAGTGCTACTTTGATACAGCCGCTCCAGATGCGTGTGAC

AATATCTTGGCCCGAAACGTGACGTGGCAGGAGTGCTGCTGTACTGTGGGAGAAGGCTGGGGCAGCGGCTGCCGCATCCAACAGTGCCCGGGCACCGAGA

CAG - UNI11251 - - UNI35715 - CTGAATACCAGTCATTGTGTCCTCACGGCCGGGGCTACCTGGTGCCCAGTGGAGACCTGAGTGCCCGGAG

AG - UNI17324 - ATGTGGACGAATGCCAACTCTTCCAGGACCAGGTGTGCAAGAGCGGAGTGTGTGTGAACACGGCCCCAGGCTACTCTTGCTATT

GCAGCAACGGGTTCTACTATCACGCACACAGGCTGGAGTGCGTTG - UNI10748 - ATAATGACGAATGTGCGGACGAGGAGCCTGCTTGTGAAGGT

GGCCGCTGCGTCAACACGGTGGGCTCTTACCACTGTACCTGCGAGCCCCCACTGGTGCTGGACGGCTCCCGGCGACGCTGCGTCTCCAACGAGAGCCAGA

GCCTGG - UNI11243 - - UNI35650 - ATGACAATCTAGGAGTGTGCTGGCAGGAAGTGGGACCTGATCTCGTCTGCAGTCGCCCACGACTAGA

CCGGCAGGCCACCTACACCGAGTGCTGCTGTCTCTATGGTGAAGCCTGGGGTATGGACTGCGCTCTCTGTCCTGCCCAGGACTCAG - UNI35650 - 

ATGACTTTGAGGCCCTTTGCAATGTGCTGCGTCCACCTGCCTATGGCCCGCCGCGCCCTGGTGGCTTTGGAATTCCCTATGAATATGGCCCAGATATAGG

CCCACCTTATCAGAGTCTCCCCTATGGGCCAGATCTGTATCCACCGCCAGTGCTACCCTACGACCCCTACCCACCCCCACCTGGACCCTTTGCTCGCCGG

GAGGCCCCTTATGGCGCCCCACCCTTCGACATGCCGGACTTTGAGGATGATGGTGGCCCCTATGGCGAGTCTGAGACTCCTGACCCACCTAGCCGAGGCA

CTGGTTGGCCTTATCGGTCCAGAGACACCCGTGGCTCCTTCCCAGAGCCTGAGGAATCCTCTGAGCGTGGAAGCTATACAG - UNI13716 - - UNI

35650 - GAGCCTTGTCTGAGCCCTATGAGGGCCTAGAGGCCGAAGAGTGTGGTATCCTGGATGGCTGCCCTCACGGCCGCTGTGTGCGCGTTCCAGAA

GGCTTCACCTGCGATTGTTTCGATGGCTACCGCCTGGACATCACCCGCATGTCCTGTGTCGGTGAGGAAGGGGAGGAGAGAGAAGGGTGAAATAAAAGCA

AGTTTGACCAGATGGTGATCAGGAACCTCC
Translation
MAGGAQLLWVSLLVLLAQLGPQPVLGRPRERLRVRFTPAVCGLRCIHGPTGSRCTPTCAPRNATSVDSGAPGGAAPGGPGFRAF - UNI22426 - FL

CPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAMPGLTRSVYTMPLANHRDDEHG - UNI11239 - GVASMVSVHVEHPQEASVVVHQV

ERVSGPWEEANPEALARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGSE CASPLPGLRTQEVCCRGEGLAWGVHDCHPCAEHLR - U

NI23644 - RNSNQVSGPNGPCPPGFERVNGSCVD - UNI36327 - DVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCIS - UNI32

233 - - UNI36327 - SQHVISEAKGPCYRVLHDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPYGSE - UNI32233 - - UNI33544 

- - UNI36327 - EGFREICPAGPGYHYSASDLRYNTRPLNQDPPRVTFNQPRVPPATPRPPTG - UNI32233 - - UNI33544 - GFLPTRR

PEPRPDPGPQPEPRPRPEPRPRPESRPRPEPRPRPEPRPQPESQPRPESRPRPESQPWPEFPLPSIPAWTGPEIPESG - UNI11152 - - UNI322

39 - - UNI33544 - GPSSSMCQRNPQVCGPGRCVPRPSGYTCACDPGFRLGPQGTRCID - UNI32239 - DIDECRRVPTPCAPGRCENTPGS

FRCVCGTGFQAGPRATECLD - UNI32239 - DVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQD - UNI16474 - DVDECTQSP

GLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQD DVDECSRSPSPCAYGRCENTEGSFKC

VCPTGFQPNAAGSECED DVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTD DVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPG

PCAD DINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLD DVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLD DIDECRER

GPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDD DIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQD DVDECRNRSFCGAHAM

CQNLPGSFQCVCDQGYEGARDGRHCVD - UNI1502 - DVNECETLQGVCGSALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRAPAG - UNI1123

2 - - UNI35715 - GTFPGSQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQ

CPGTETA - UNI11251 - - UNI35715 - AEYQSLCPHGRGYLVPSGDLSARRD - UNI17324 - DVDECQLFQDQVCKSGVCVNTAPGYSC

YCSNGFYYHAHRLECVD - UNI10748 - DNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSRRRCVSNESQSLD - UNI11243 - - UNI

35650 - DDNLGVCWQEVGPDLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSD - UNI35650 - DDFEALCNVLRPPAYGPPRPGGFGIP

YEYGPDIGPPYQSLPYGPDLYPPPVLPYDPYPPPPGPFARREAPYGAPPFDMPDFEDDGGPYGESETPDPPSRGTGWPYRSRDTRGSFPEPEESSERGSY

TG - UNI13716 - - UNI35650 - GALSEPYEGLEAEECGILDGCPHGRCVRVPEGFTCDCFDGYRLDITRMSCVGEEGEEREG
Transcript ENSMUST00000121175
Sequence
GCGGCCGGGCCCCTCGGGCGGGCTGGGGCGGCGGCGCGGTGGAGCGCGGCGCTGCAGCCATGGCGGGCGGCGCGCAGCTGCTCTGGGTGTCGCTATTGGT

GCTGCTGGCGCAGCTGGGGCCGCAGCCCGTACTGGGCCGACCCCGAGAGCGTCTTCGCGTGCGCTTCACCCCCGCTGTGTGCGGCCTGCGTTGCATCCAC

GGGCCCACTGGCTCCCGCTGTACCCCGACCTGCGCGCCCCGCAACGCCACCAGCGTGGACAGCGGCGCGCCCGGCGGGGCGGCCCCGGGGGGACCCGGCT

TCCGCGCCT - UNI22426 - TCCTATGTCCCTTGATCTGTCACAACGGTGGTGTGTGTGTGAAGCCTGATCGCTGCCTTTGCCCCCCGGACTTCGCT

GGCAAATTCTGCCAATTGCATTCTTCGGGGGCCCGGCCCCCGGCCCCAGCCATGCCGGGCCTTACCCGCTCCGTTTATACAATGCCACTAGCCAACCACC

GCGATGATGAACACG - UNI11239 - GAGTAGCATCGATGGTGAGCGTGCACGTGGAGCACCCTCAGGAGGCATCAGTGGTGGTGCACCAAGTGGAA

CGTGTGTCGGGCCCCTGGGAGGAGGCGAACCCTGAAGCCCTAGCCAGGGCTGAAGCGGCGGCACGGGCCGAGGCGGCGGCGCCCTACACAGTGCTGGCAC

AGAGCGCGCCACGCGAGGACGGCTACTCAGACGCCTCCGGCTTCGGTTACTGTTTTAGAGAACTGCGCGGAAGCGAA TGTGCATCGCCGCTGCCAGGGC

TCCGGACGCAGGAAGTCTGCTGCCGAGGAGAGGGCTTGGCCTGGGGTGTTCATGATTGTCACCCGTGCGCGGAACACCTGA - UNI23644 - GGAAC

TCCAACCAAGTGAGTGGCCCAAATGGACCTTGTCCACCCGGCTTCGAGAGAGTTAATGGGTCCTGTGTAG - UNI36327 - ATGTGGATGAGTGCGC

CACCGGTGGGCGTTGCCAACACGGGGAGTGTGCCAACACTCGTGGCGGCTACACGTGTGTATGTCCGGACGGTTTCCTCCTGGACTCTTCCCGCAGCAGC

TGCATCT - UNI32233 - - UNI36327 - CCCAACACGTGATCTCCGAGGCAAAGGGGCCCTGCTACCGAGTGCTGCATGATGGCGGATGCTCGC

TGCCCATTCTTCGAAATATCACCAAACAGATCTGCTGCTGTAGCCGTGTGGGCAAGGCGTGGGGCCGAGGCTGCCAGCTCTGTCCACCTTATGGTTCAG 

- UNI32233 - - UNI33544 - - UNI36327 - AGGGTTTTCGGGAGATCTGTCCAGCTGGCCCTGGCTACCACTATTCAGCTTCTGACCTCCG

ATACAACACCAGACCCCTAAACCAGGATCCACCTCGAGTGACCTTCAATCAGCCACGTGTTCCACCAGCCACCCCTCGGCCACCTACAG - UNI32233

 - - UNI33544 - GCTTTCTGCCTACTCGTCGACCTGAGCCCCGCCCTGACCCTGGGCCACAGCCTGAACCCCGGCCTCGGCCTGAACCCCGGCCTC

GGCCTGAATCCCGACCTCGGCCTGAACCCCGGCCTCGGCCTGAACCCCGGCCTCAGCCTGAATCCCAGCCTAGGCCTGAATCCCGGCCTCGGCCTGAATC

CCAGCCTTGGCCTGAATTTCCCCTGCCCAGCATCCCTGCTTGGACCGGTCCAGAGATTCCTGAATCAG - UNI11152 - - UNI32239 - - UNI

33544 - GTCCCTCTTCCAGCATGTGTCAGCGAAATCCCCAGGTTTGTGGTCCTGGACGCTGCGTTCCTAGGCCAAGCGGCTACACTTGTGCGTGCGAC

CCAGGTTTCCGGCTCGGCCCCCAGGGCACTCGCTGCATTG - UNI32239 - ACATAGATGAATGTCGCCGCGTCCCTACACCCTGTGCTCCTGGGCG

TTGCGAGAATACACCAGGCAGCTTTCGCTGCGTGTGCGGCACGGGCTTCCAAGCAGGCCCGCGGGCTACAGAGTGCCTGG - UNI32239 - ATGTGG

ACGAGTGCCGCCGCGTGCCGCCGCCGTGTGACCGCGGGCGCTGCGAGAACACGCCAGGCAGTTTCCTATGTGTGTGTCCCGCCGGGTACCAGGCAGCACC

GCACGGAGCCAGCTGCCAGG - UNI16474 - ATGTGGATGAATGCACCCAGAGCCCAGGCCTCTGTGGTCGCGGGGTCTGCGAAAACCTGCCCGGCT

CTTTCCGCTGTGTTTGCCCGGCTGGCTTCCGGGGCTCGGCGTGTGAAGAAGATGTGGATGAATGTGCCCAGCAGCCTCCGCCTTGCGGGCCAGGCCGCTG

CGACAACACCGCGGGTTCGTTCCACTGTGCCTGCCCAGCTGGCTTCCGATCCCGAGGACCAGGAGCCCCCTGCCAAG ATGTGGATGAATGTTCCCGGAG

CCCCTCGCCTTGTGCCTATGGCCGCTGTGAGAACACGGAAGGCAGCTTCAAGTGTGTCTGCCCAACAGGCTTCCAACCCAACGCTGCGGGCTCCGAGTGC

GAGG ATGTGGATGAGTGTGAGAACCGCTTGGCGTGTCCAGGGCAGGAGTGTGTGAACTCACCGGGCTCCTTCCAGTGCCGGGCCTGCCCTGTTGGGCAC

CACCTGCACCGTGGCAGATGTACTG ATGTGGATGAATGCAGTTCGGGCACCCCTTGTGGTCTCCATGGCCAGTGCACAAATACTAAAGGCTCCTTCCAC

TGCAGCTGCTCGACAGGTTACCGGGCGCCATCTGGTCAACCTGGGCCTTGTGCAG ACATAAATGAGTGTCTGGAAGGCGACTTCTGCTTCCCCCACGGA

GAGTGCCTCAACACTGATGGCTCCTTTACCTGTACCTGTGCCCCTGGCTACCGGCCTGGACCTCGTGGAGCATCTTGTCTGG ACGTGGACGAGTGCAGC

GAAGAGGATCTTTGCCAGAGCGGCATCTGTACCAACACTGACGGCTCCTTCGAGTGCATCTGTCCTCCTGGACACCGCGCTGGCCCTGACCTTGCCTCCT

GCCTTG ACATTGACGAGTGTCGTGAACGGGGACCTGCCCTGTGCGGGTCTCAGCGCTGTGAAAATTCTCCTGGTTCCTACCGCTGTGTGCGGGACTGCG

ATCCAGGTTACCACCCCGGCCCTGAGGGCACCTGTGATG ACATTGATGAGTGCCGAGAATACGGCTCTGCGATTTGTGGTGCCCAGCGCTGTGAGAACA

CCCCGGGCTCCTACCGCTGCACACCAGCCTGCGACCCTGGCTATCAGCCTACACCAGGGGGCGGGTGCCAAG ATGTGGATGAATGCCGGAACCGGTCTT

TCTGCGGCGCCCATGCTATGTGCCAGAATCTGCCTGGGTCCTTTCAGTGCGTCTGTGACCAAGGCTACGAAGGGGCACGGGACGGACGTCACTGCGTGG 

- UNI1502 - ATGTGAATGAGTGTGAGACACTACAGGGCGTGTGTGGCTCCGCGCTGTGTGAAAATGTTGAAGGCTCCTTCCTGTGTGTCTGCCCCAA

TAGCCCTGAGGAATTTGATCCCATGACTGGACGCTGTGTTCCCCCACGGGCTCCTGCAG - UNI11232 - - UNI35715 - GCACGTTCCCTGGC

TCCCAGCCCCAAGCACCTGCCAGCCCCAGTCTTCCAGCCAGGCCACCAGCCCCTCCCCCACCTCGAAGACCCAGCCCTCCCAGGCAGGGTCCCGTGAGCA

GTGGACGTCGCGAGTGCTACTTTGATACAGCCGCTCCAGATGCGTGTGACAATATCTTGGCCCGAAACGTGACGTGGCAGGAGTGCTGCTGTACTGTGGG

AGAAGGCTGGGGCAGCGGCTGCCGCATCCAACAGTGCCCGGGCACCGAGACAG - UNI11251 - - UNI35715 - CTGAATACCAGTCATTGTGT

CCTCACGGCCGGGGCTACCTGGTGCCCAGTGGAGACCTGAGTGCCCGGAGAG - UNI17324 - ATGTGGACGAATGCCAACTCTTCCAGGACCAGGT

GTGCAAGAGCGGAGTGTGTGTGAACACGGCCCCAGGCTACTCTTGCTATTGCAGCAACGGGTTCTACTATCACGCACACAGGCTGGAGTGCGTTG - UN

I10748 - ATAATGACGAATGTGCGGACGAGGAGCCTGCTTGTGAAGGTGGCCGCTGCGTCAACACGGTGGGCTCTTACCACTGTACCTGCGAGCCCCC

ACTGGTGCTGGACGGCTCCCGGCGACGCTGCGTCTCCAACGAGAGCCAGAGCCTGG - UNI11243 - - UNI35650 - ATGACAATCTAGGAGTG

TGCTGGCAGGAAGTGGGACCTGATCTCGTCTGCAGTCGCCCACGACTAGACCGGCAGGCCACCTACACCGAGTGCTGCTGTCTCTATGGTGAAGCCTGGG

GTATGGACTGCGCTCTCTGTCCTGCCCAGGACTCAG - UNI35650 - ATGACTTTGAGGCCCTTTGCAATGTGCTGCGTCCACCTGCCTATGGCCCG

CCGCGCCCTGGTGGCTTTGGAATTCCCTATGAATATGGCCCAGATATAGGCCCACCTTATCAGAGTCTCCCCTATGGGCCAGATCTGTATCCACCGCCAG

TGCTACCCTACGACCCCTACCCACCCCCACCTGGACCCTTTGCTCGCCGGGAGGCCCCTTATGGCGCCCCACCCTTCGACATGCCGGACTTTGAGGATGA

TGGTGGCCCCTATGGCGAGTCTGAGACTCCTGACCCACCTAGCCGAGGCACTGGTTGGCCTTATCGGTCCAGAGACACCCGTGGCTCCTTCCCAGAGCCT

GAGGAATCCTCTGAGCGTGGAAGCTATACAG - UNI13716 - - UNI35650 - GAGCCTTGTCTGAGCCCTATGAGGGCCTAGAGGCCGAAGAGT

GTGGTATCCTGGATGGCTGCCCTCACGGCCGCTGTGTGCGCGTTCCAGAAGGCTTCACCTGCGATTGTTTCGATGGCTACCGCCTGGACATCACCCGCAT

GTCCTGTGTCG - UNI13716 - - UNI21265 - ACGTCAACGAGTGTGATGAGGCAGAGGCAACCTCCCCACTCTGCGTCAATGCGCGCTGTGTC

AACACTGACGGCTCCTTCCGCTGTATCTGTCGTCCAGGATTTGCTCCCACGCATCAGCCACATCACTGTGCGCCTGCTCGACCCCGGGCCTGAGCAGGGG

CGCCAAATCTCCCACTATACCTGAGCACCGGGAGCTTCCAGAGCACGCCTGCCTCCCTCCCTCTAGTCTGCATGTGTGCAAGGATGTCAGACAGTCTCGA

CTTAGGATGGACAGACACAGAGGGGTGCCTTCTATGGTGCCAGCCTGTCATGCCCAGTCCCTCCCACCAGTGCCCTGGGCCTGTCCTGGGTCCCCTGACA

CATTTCTTGCCCTTTTATACAATTTTCAATTAAAACACCTATTTTGTAC
Translation
MAGGAQLLWVSLLVLLAQLGPQPVLGRPRERLRVRFTPAVCGLRCIHGPTGSRCTPTCAPRNATSVDSGAPGGAAPGGPGFRAF - UNI22426 - FL

CPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAMPGLTRSVYTMPLANHRDDEHG - UNI11239 - GVASMVSVHVEHPQEASVVVHQV

ERVSGPWEEANPEALARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGSE CASPLPGLRTQEVCCRGEGLAWGVHDCHPCAEHLR - U

NI23644 - RNSNQVSGPNGPCPPGFERVNGSCVD - UNI36327 - DVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCIS - UNI32

233 - - UNI36327 - SQHVISEAKGPCYRVLHDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPYGSE - UNI32233 - - UNI33544 

- - UNI36327 - EGFREICPAGPGYHYSASDLRYNTRPLNQDPPRVTFNQPRVPPATPRPPTG - UNI32233 - - UNI33544 - GFLPTRR

PEPRPDPGPQPEPRPRPEPRPRPESRPRPEPRPRPEPRPQPESQPRPESRPRPESQPWPEFPLPSIPAWTGPEIPESG - UNI11152 - - UNI322

39 - - UNI33544 - GPSSSMCQRNPQVCGPGRCVPRPSGYTCACDPGFRLGPQGTRCID - UNI32239 - DIDECRRVPTPCAPGRCENTPGS

FRCVCGTGFQAGPRATECLD - UNI32239 - DVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQD - UNI16474 - DVDECTQSP

GLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQD DVDECSRSPSPCAYGRCENTEGSFKC

VCPTGFQPNAAGSECED DVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTD DVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPG

PCAD DINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLD DVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLD DIDECRER

GPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDD DIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQD DVDECRNRSFCGAHAM

CQNLPGSFQCVCDQGYEGARDGRHCVD - UNI1502 - DVNECETLQGVCGSALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRAPAG - UNI1123

2 - - UNI35715 - GTFPGSQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQ

CPGTETA - UNI11251 - - UNI35715 - AEYQSLCPHGRGYLVPSGDLSARRD - UNI17324 - DVDECQLFQDQVCKSGVCVNTAPGYSC

YCSNGFYYHAHRLECVD - UNI10748 - DNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSRRRCVSNESQSLD - UNI11243 - - UNI

35650 - DDNLGVCWQEVGPDLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSD - UNI35650 - DDFEALCNVLRPPAYGPPRPGGFGIP

YEYGPDIGPPYQSLPYGPDLYPPPVLPYDPYPPPPGPFARREAPYGAPPFDMPDFEDDGGPYGESETPDPPSRGTGWPYRSRDTRGSFPEPEESSERGSY

TG - UNI13716 - - UNI35650 - GALSEPYEGLEAEECGILDGCPHGRCVRVPEGFTCDCFDGYRLDITRMSCVD - UNI13716 - - UNI

21265 - DVNECDEAEATSPLCVNARCVNTDGSFRCICRPGFAPTHQPHHCAPARPRA
Transcript ENSMUST00000108369
Sequence
TTGCACGGTGGAGAAAGTGAGTCGGCCTCTGGCTGAGGCGGGGGTAGGGGGCGGGACCGGGGCCAGGCCGATCCGGACCCACTGGACACACTGCCCTCTT

GGAGCCGGACTCTGCACCCGACACGATGCGCCGGCCTGGCCTCGGCGGCCCCTGCCCCCTCTTGCTGCTGCTGCTGCTCCCAGCCGCCACATCTGCTAGC

GGCTCCAGTCCCAGCCCCAGCCCCAGCCCCATCGAGAAAGCGGTGGTCCCGAGCCACCAGGCCGG - UNI31843 - TGTTGCTGCCTGTCACTGCTG

CCTAGACCAGACAC - UNI11249 - - UNI24574 - - UNI31843 - CGCGGTGGAGCGCGGCGCTGCAGCCATGGCGGGCGGCGCGCAGCTG

CTCTGGGTGTCGCTATTGGTGCTGCTGGCGCAGCTGGGGCCGCAGCCCGTACTGGGCCGACCCCGAGAGCGTCTTCGCGTGCGCTTCACCCCCGCTGTGT

GCGGCCTGCGTTGCATCCACGGGCCCACTGGCTCCCGCTGTACCCCGACCTGCGCGCCCCGCAACGCCACCA GTGGACAGCGGCGCGCCCGGCGGGGCG

GCCCCGGGGGGACCCGGCTTCCGCGCCT - UNI22426 - TCCTATGTCCCTTGATCTGTCACAACGGTGGTGTGTGTGTGAAGCCTGATCGCTGCCT

TTGCCCCCCGGACTTCGCTGGCAAATTCTGCCAATTGCATTCTTCGGGGGCCCGGCCCCCGGCCCCAGCCATGCCGGGCCTTACCCGCTCCGTTTATACA

ATGCCACTAGCCAACCACCGCGATGATGAACACG - UNI11239 - GAGTAGCATCGATGGTGAGCGTGCACGTGGAGCACCCTCAGGAGGCATCAGT

GGTGGTGCACCAAGTGGAACGTGTGTCGGGCCCCTGGGAGGAGGCGAACCCTGAAGCCCTAGCCAGGGCTGAAGCGGCGGCACGGGCCGAGGCGGCGGCG

CCCTACACAGTGCTGGCACAGAGCGCGCCACGCGAGGACGGCTACTCAGACGCCTCCGGCTTCGGTTACTGTTTTAGAGAACTGCGCGGAAGCGAA TGT

GCATCGCCGCTGCCAGGGCTCCGGACGCAGGAAGTCTGCTGCCGAGGAGAGGGCTTGGCCTGGGGTGTTCATGATTGTCACCCGTGCGCGGAACACCTGA

 - UNI23644 - GGAACTCCAACCAAGTGAGTGGCCCAAATGGACCTTGTCCACCCGGCTTCGAGAGAGTTAATGGGTCCTGTGTAG - UNI36327

 - ATGTGGATGAGTGCGCCACCGGTGGGCGTTGCCAACACGGGGAGTGTGCCAACACTCGTGGCGGCTACACGTGTGTATGTCCGGACGGTTTCCTCCT

GGACTCTTCCCGCAGCAGCTGCATCT - UNI32233 - - UNI36327 - CCCAACACGTGATCTCCGAGGCAAAGGGGCCCTGCTACCGAGTGCTG

CATGATGGCGGATGCTCGCTGCCCATTCTTCGAAATATCACCAAACAGATCTGCTGCTGTAGCCGTGTGGGCAAGGCGTGGGGCCGAGGCTGCCAGCTCT

GTCCACCTTATGGTTCAG - UNI32233 - - UNI33544 - - UNI36327 - AGGGTTTTCGGGAGATCTGTCCAGCTGGCCCTGGCTACCACT

ATTCAGCTTCTGACCTCCGATACAACACCAGACCCCTAAACCAGGATCCACCTCGAGTGACCTTCAATCAGCCACGTGTTCCACCAGCCACCCCTCGGCC

ACCTACAG - UNI32233 - - UNI33544 - GCTTTCTGCCTACTCGTCGACCTGAGCCCCGCCCTGACCCTGGGCCACAGCCTGAACCCCGGCCT

CGGCCTGAACCCCGGCCTCGGCCTGAATCCCGACCTCGGCCTGAACCCCGGCCTCGGCCTGAACCCCGGCCTCAGCCTGAATCCCAGCCTAGGCCTGAAT

CCCGGCCTCGGCCTGAATCCCAGCCTTGGCCTGAATTTCCCCTGCCCAGCATCCCTGCTTGGACCGGTCCAGAGATTCCTGAATCAG - UNI11152 -

 - UNI32239 - - UNI33544 - GTCCCTCTTCCAGCATGTGTCAGCGAAATCCCCAGGTTTGTGGTCCTGGACGCTGCGTTCCTAGGCCAAGCGG

CTACACTTGTGCGTGCGACCCAGGTTTCCGGCTCGGCCCCCAGGGCACTCGCTGCATTG - UNI32239 - ACATAGATGAATGTCGCCGCGTCCCTA

CACCCTGTGCTCCTGGGCGTTGCGAGAATACACCAGGCAGCTTTCGCTGCGTGTGCGGCACGGGCTTCCAAGCAGGCCCGCGGGCTACAGAGTGCCTGG 

- UNI32239 - ATGTGGACGAGTGCCGCCGCGTGCCGCCGCCGTGTGACCGCGGGCGCTGCGAGAACACGCCAGGCAGTTTCCTATGTGTGTGTCCCG

CCGGGTACCAGGCAGCACCGCACGGAGCCAGCTGCCAGG - UNI16474 - ATGTGGATGAATGCACCCAGAGCCCAGGCCTCTGTGGTCGCGGGGTC

TGCGAAAACCTGCCCGGCTCTTTCCGCTGTGTTTGCCCGGCTGGCTTCCGGGGCTCGGCGTGTGAAGAAGATGTGGATGAATGTGCCCAGCAGCCTCCGC

CTTGCGGGCCAGGCCGCTGCGACAACACCGCGGGTTCGTTCCACTGTGCCTGCCCAGCTGGCTTCCGATCCCGAGGACCAGGAGCCCCCTGCCAAG ATG

TGGATGAATGTTCCCGGAGCCCCTCGCCTTGTGCCTATGGCCGCTGTGAGAACACGGAAGGCAGCTTCAAGTGTGTCTGCCCAACAGGCTTCCAACCCAA

CGCTGCGGGCTCCGAGTGCGAGG ATGTGGATGAGTGTGAGAACCGCTTGGCGTGTCCAGGGCAGGAGTGTGTGAACTCACCGGGCTCCTTCCAGTGCCG

GGCCTGCCCTGTTGGGCACCACCTGCACCGTGGCAGATGTACTG ATGTGGATGAATGCAGTTCGGGCACCCCTTGTGGTCTCCATGGCCAGTGCACAAA

TACTAAAGGCTCCTTCCACTGCAGCTGCTCGACAGGTTACCGGGCGCCATCTGGTCAACCTGGGCCTTGTGCAG ACATAAATGAGTGTCTGGAAGGCGA

CTTCTGCTTCCCCCACGGAGAGTGCCTCAACACTGATGGCTCCTTTACCTGTACCTGTGCCCCTGGCTACCGGCCTGGACCTCGTGGAGCATCTTGTCTG

G ACGTGGACGAGTGCAGCGAAGAGGATCTTTGCCAGAGCGGCATCTGTACCAACACTGACGGCTCCTTCGAGTGCATCTGTCCTCCTGGACACCGCGCT

GGCCCTGACCTTGCCTCCTGCCTTG ACATTGACGAGTGTCGTGAACGGGGACCTGCCCTGTGCGGGTCTCAGCGCTGTGAAAATTCTCCTGGTTCCTAC

CGCTGTGTGCGGGACTGCGATCCAGGTTACCACCCCGGCCCTGAGGGCACCTGTGATG ACATTGATGAGTGCCGAGAATACGGCTCTGCGATTTGTGGT

GCCCAGCGCTGTGAGAACACCCCGGGCTCCTACCGCTGCACACCAGCCTGCGACCCTGGCTATCAGCCTACACCAGGGGGCGGGTGCCAAG ATGTGGAT

GAATGCCGGAACCGGTCTTTCTGCGGCGCCCATGCTATGTGCCAGAATCTGCCTGGGTCCTTTCAGTGCGTCTGTGACCAAGGCTACGAAGGGGCACGGG

ACGGACGTCACTGCGTGG - UNI1502 - ATGTGAATGAGTGTGAGACACTACAGGGCGTGTGTGGCTCCGCGCTGTGTGAAAATGTTGAAGGCTCCT

TCCTGTGTGTCTGCCCCAATAGCCCTGAGGAATTTGATCCCATGACTGGACGCTGTGTTCCCCCACGGGCTCCTGCAG - UNI11232 - - UNI357

15 - GCACGTTCCCTGGCTCCCAGCCCCAAGCACCTGCCAGCCCCAGTCTTCCAGCCAGGCCACCAGCCCCTCCCCCACCTCGAAGACCCAGCCCTCCC

AGGCAGGGTCCCGTGAGCAGTGGACGTCGCGAGTGCTACTTTGATACAGCCGCTCCAGATGCGTGTGACAATATCTTGGCCCGAAACGTGACGTGGCAGG

AGTGCTGCTGTACTGTGGGAGAAGGCTGGGGCAGCGGCTGCCGCATCCAACAGTGCCCGGGCACCGAGACAG - UNI11251 - - UNI35715 - C

TGAATACCAGTCATTGTGTCCTCACGGCCGGGGCTACCTGGTGCCCAGTGGAGACCTGAGTGCCCGGAGAG - UNI17324 - ATGTGGACGAATGCC

AACTCTTCCAGGACCAGGTGTGCAAGAGCGGAGTGTGTGTGAACACGGCCCCAGGCTACTCTTGCTATTGCAGCAACGGGTTCTACTATCACGCACACAG

GCTGGAGTGCGTTG - UNI10748 - ATAATGACGAATGTGCGGACGAGGAGCCTGCTTGTGAAGGTGGCCGCTGCGTCAACACGGTGGGCTCTTACC

ACTGTACCTGCGAGCCCCCACTGGTGCTGGACGGCTCCCGGCGACGCTGCGTCTCCAACGAGAGCCAGAGCCTGG - UNI11243 - - UNI35650 

- ATGACAATCTAGGAGTGTGCTGGCAGGAAGTGGGACCTGATCTCGTCTGCAGTCGCCCACGACTAGACCGGCAGGCCACCTACACCGAGTGCTGCTGT

CTCTATGGTGAAGCCTGGGGTATGGACTGCGCTCTCTGTCCTGCCCAGGACTCAG - UNI35650 - ATGACTTTGAGGCCCTTTGCAATGTGCTGCG

TCCACCTGCCTATGGCCCGCCGCGCCCTGGTGGCTTTGGAATTCCCTATGAATATGGCCCAGATATAGGCCCACCTTATCAGAGTCTCCCCTATGGGCCA

GATCTGTATCCACCGCCAGTGCTACCCTACGACCCCTACCCACCCCCACCTGGACCCTTTGCTCGCCGGGAGGCCCCTTATGGCGCCCCACCCTTCGACA

TGCCGGACTTTGAGGATGATGGTGGCCCCTATGGCGAGTCTGAGACTCCTGACCCACCTAGCCGAGGCACTGGTTGGCCTTATCGGTCCAGAGACACCCG

TGGCTCCTTCCCAGAGCCTGAGGAATCCTCTGAGCGTGGAAGCTATACAG - UNI13716 - - UNI35650 - GAGCCTTGTCTGAGCCCTATGAG

GGCCTAGAGGCCGAAGAGTGTGGTATCCTGGATGGCTGCCCTCACGGCCGCTGTGTGCGCGTTCCAGAAGGCTTCACCTGCGATTGTTTCGATGGCTACC

GCCTGGACATCACCCGCATGTCCTGTGTCG - UNI13716 - - UNI21265 - ACGTCAACGAGTGTGATGAGGCAGAGGCAACCTCCCCACTCTG

CGTCAATGCGCGCTGTGTCAACACTGACGGCTCCTTCCGCTGTATCTGTCGTCCAGGATTTGCTCCCACGCATCAGCCACATCACTGTGCGCCTGCTCGA

CCCCGGGCCTGAGCAGGGGCGCCAAATCTCCCACTATACCTGAGCACCGGGAGCTTCCAGAGCACGCCTGCCTCCCTCCCTCTAGTCTGCATGTGTGCAA

GGATGTCAGACAGTCTCGACTTAGGATGGACAGACACAGAGGGGTGCCTTCTATGGTGCCAGCCTGTCATGCCCAGTCCCTCCCACCAGTGCCCTGGGCC

TGTCCTGGGTCCCCTGACACATTTCTTGCCCTTTTATACAATTTTCAATTAAAACACCTATTTTGT
Translation
MRRPGLGGPCPLLLLLLLPAATSASGSSPSPSPSPIEKAVVPSHQAG - UNI31843 - GVAACHCCLDQTP - UNI11249 - - UNI24574 -

 - UNI31843 - PRWSAALQPWRAARSCSGCRYWCCWRSWGRSPYWADPESVFACASPPLCAACVASTGPLAPAVPRPARPATPP VDSGAPGGAAPG

GPGFRAF - UNI22426 - FLCPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAMPGLTRSVYTMPLANHRDDEHG - UNI11239 - 

GVASMVSVHVEHPQEASVVVHQVERVSGPWEEANPEALARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGSE CASPLPGLRTQEVCCR

GEGLAWGVHDCHPCAEHLR - UNI23644 - RNSNQVSGPNGPCPPGFERVNGSCVD - UNI36327 - DVDECATGGRCQHGECANTRGGYTCVC

PDGFLLDSSRSSCIS - UNI32233 - - UNI36327 - SQHVISEAKGPCYRVLHDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPYGSE -

 UNI32233 - - UNI33544 - - UNI36327 - EGFREICPAGPGYHYSASDLRYNTRPLNQDPPRVTFNQPRVPPATPRPPTG - UNI32233

 - - UNI33544 - GFLPTRRPEPRPDPGPQPEPRPRPEPRPRPESRPRPEPRPRPEPRPQPESQPRPESRPRPESQPWPEFPLPSIPAWTGPEIPES

G - UNI11152 - - UNI32239 - - UNI33544 - GPSSSMCQRNPQVCGPGRCVPRPSGYTCACDPGFRLGPQGTRCID - UNI32239 - 

DIDECRRVPTPCAPGRCENTPGSFRCVCGTGFQAGPRATECLD - UNI32239 - DVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQD

 - UNI16474 - DVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQD DVD

ECSRSPSPCAYGRCENTEGSFKCVCPTGFQPNAAGSECED DVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTD DVDECSSGTPCGLHGQC

TNTKGSFHCSCSTGYRAPSGQPGPCAD DINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLD DVDECSEEDLCQSGICTNTDGSFECICP

PGHRAGPDLASCLD DIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDD DIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTP

GGGCQD DVDECRNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVD - UNI1502 - DVNECETLQGVCGSALCENVEGSFLCVCPNSPEEFDP

MTGRCVPPRAPAG - UNI11232 - - UNI35715 - GTFPGSQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECYFDTAAPDACDNILAR

NVTWQECCCTVGEGWGSGCRIQQCPGTETA - UNI11251 - - UNI35715 - AEYQSLCPHGRGYLVPSGDLSARRD - UNI17324 - DVDE

CQLFQDQVCKSGVCVNTAPGYSCYCSNGFYYHAHRLECVD - UNI10748 - DNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSRRRCVSNES

QSLD - UNI11243 - - UNI35650 - DDNLGVCWQEVGPDLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSD - UNI35650 - DDF

EALCNVLRPPAYGPPRPGGFGIPYEYGPDIGPPYQSLPYGPDLYPPPVLPYDPYPPPPGPFARREAPYGAPPFDMPDFEDDGGPYGESETPDPPSRGTGW

PYRSRDTRGSFPEPEESSERGSYTG - UNI13716 - - UNI35650 - GALSEPYEGLEAEECGILDGCPHGRCVRVPEGFTCDCFDGYRLDITRM

SCVD - UNI13716 - - UNI21265 - DVNECDEAEATSPLCVNARCVNTDGSFRCICRPGFAPTHQPHHCAPARPRA
Transcript ENSMUST00000038618
Sequence
TTGCACGGTGGAGAAAGTGAGTCGGCCTCTGGCTGAGGCGGGGGTAGGGGGCGGGACCGGGGCCAGGCCGATCCGGACCCACTGGACACACTGCCCTCTT

GGAGCCGGACTCTGCACCCGACACGATGCGCCGGCCTGGCCTCGGCGGCCCCTGCCCCCTCTTGCTGCTGCTGCTGCTCCCAGCCGCCACATCTGCTAGC

GGCTCCAGTCCCAGCCCCAGCCCCAGCCCCATCGAGAAAGCGGTGGTCCCGAGCCACCAGGCCGG - UNI31843 - TGTTGCTGCCTGTCACTGCTG

CCTAGACCAGACACCTAAGAGTAGCCGCTGCACCCGAG - UNI24574 - CTTCCTGCAGGGTCCGGAACTGCCCACCTGCCAAGTGCACAGGTCTAG

AGGGGTGCCTGACCCCAACACCTTCGGTGCCCAGCCCCAGCCGCAGTCCCGTGGAGAAGAGTCAGGTATCCCTCAACTGGCAGCCACTGAC TTTGCAGG

AGGCCCGAGCTCTGCTGAGGCAAAGGCGGCCCCGAGGGCCGTGGGCCCGGGCATTGCTGAAAAGAAGGCCCCCACATCGCGCCCCTGCCGGCCAGGCCCG

GG - UNI11249 - - UNI22426 - TCCTATGTCCCTTGATCTGTCACAACGGTGGTGTGTGTGTGAAGCCTGATCGCTGCCTTTGCCCCCCGGAC

TTCGCTGGCAAATTCTGCCAATTGCATTCTTCGGGGGCCCGGCCCCCGGCCCCAGCCATGCCGGGCCTTACCCGCTCCGTTTATACAATGCCACTAGCCA

ACCACCGCGATGATGAACACG - UNI11239 - GAGTAGCATCGATGGTGAGCGTGCACGTGGAGCACCCTCAGGAGGCATCAGTGGTGGTGCACCAA

GTGGAACGTGTGTCGGGCCCCTGGGAGGAGGCGAACCCTGAAGCCCTAGCCAGGGCTGAAGCGGCGGCACGGGCCGAGGCGGCGGCGCCCTACACAGTGC

TGGCACAGAGCGCGCCACGCGAGGACGGCTACTCAGACGCCTCCGGCTTCGGTTACTGTTTTAGAGAACTGCGCGGAAGCGAA TGTGCATCGCCGCTGC

CAGGGCTCCGGACGCAGGAAGTCTGCTGCCGAGGAGAGGGCTTGGCCTGGGGTGTTCATGATTGTCACCCGTGCGCGGAACACCTGA - UNI23644 -

 GGAACTCCAACCAAGTGAGTGGCCCAAATGGACCTTGTCCACCCGGCTTCGAGAGAGTTAATGGGTCCTGTGTAG - UNI36327 - ATGTGGATGA

GTGCGCCACCGGTGGGCGTTGCCAACACGGGGAGTGTGCCAACACTCGTGGCGGCTACACGTGTGTATGTCCGGACGGTTTCCTCCTGGACTCTTCCCGC

AGCAGCTGCATCT - UNI32233 - - UNI36327 - CCCAACACGTGATCTCCGAGGCAAAGGGGCCCTGCTACCGAGTGCTGCATGATGGCGGAT

GCTCGCTGCCCATTCTTCGAAATATCACCAAACAGATCTGCTGCTGTAGCCGTGTGGGCAAGGCGTGGGGCCGAGGCTGCCAGCTCTGTCCACCTTATGG

TTCAG - UNI32233 - - UNI33544 - - UNI36327 - AGGGTTTTCGGGAGATCTGTCCAGCTGGCCCTGGCTACCACTATTCAGCTTCTGA

CCTCCGATACAACACCAGACCCCTAAACCAGGATCCACCTCGAGTGACCTTCAATCAGCCACGTGTTCCACCAGCCACCCCTCGGCCACCTACAG - UN

I32233 - - UNI33544 - GCTTTCTGCCTACTCGTCGACCTGAGCCCCGCCCTGACCCTGGGCCACAGCCTGAACCCCGGCCTCGGCCTGAACCCC

GGCCTCGGCCTGAATCCCGACCTCGGCCTGAACCCCGGCCTCGGCCTGAACCCCGGCCTCAGCCTGAATCCCAGCCTAGGCCTGAATCCCGGCCTCGGCC

TGAATCCCAGCCTTGGCCTGAATTTCCCCTGCCCAGCATCCCTGCTTGGACCGGTCCAGAGATTCCTGAATCAG - UNI11152 - - UNI32239 -

 - UNI33544 - GTCCCTCTTCCAGCATGTGTCAGCGAAATCCCCAGGTTTGTGGTCCTGGACGCTGCGTTCCTAGGCCAAGCGGCTACACTTGTGCG

TGCGACCCAGGTTTCCGGCTCGGCCCCCAGGGCACTCGCTGCATTG - UNI32239 - ACATAGATGAATGTCGCCGCGTCCCTACACCCTGTGCTCC

TGGGCGTTGCGAGAATACACCAGGCAGCTTTCGCTGCGTGTGCGGCACGGGCTTCCAAGCAGGCCCGCGGGCTACAGAGTGCCTGG - UNI32239 - 

ATGTGGACGAGTGCCGCCGCGTGCCGCCGCCGTGTGACCGCGGGCGCTGCGAGAACACGCCAGGCAGTTTCCTATGTGTGTGTCCCGCCGGGTACCAGGC

AGCACCGCACGGAGCCAGCTGCCAGG - UNI16474 - ATGTGGATGAATGCACCCAGAGCCCAGGCCTCTGTGGTCGCGGGGTCTGCGAAAACCTGC

CCGGCTCTTTCCGCTGTGTTTGCCCGGCTGGCTTCCGGGGCTCGGCGTGTGAAGAAGATGTGGATGAATGTGCCCAGCAGCCTCCGCCTTGCGGGCCAGG

CCGCTGCGACAACACCGCGGGTTCGTTCCACTGTGCCTGCCCAGCTGGCTTCCGATCCCGAGGACCAGGAGCCCCCTGCCAAG ATGTGGATGAATGTTC

CCGGAGCCCCTCGCCTTGTGCCTATGGCCGCTGTGAGAACACGGAAGGCAGCTTCAAGTGTGTCTGCCCAACAGGCTTCCAACCCAACGCTGCGGGCTCC

GAGTGCGAGG ATGTGGATGAGTGTGAGAACCGCTTGGCGTGTCCAGGGCAGGAGTGTGTGAACTCACCGGGCTCCTTCCAGTGCCGGGCCTGCCCTGTT

GGGCACCACCTGCACCGTGGCAGATGTACTG ATGTGGATGAATGCAGTTCGGGCACCCCTTGTGGTCTCCATGGCCAGTGCACAAATACTAAAGGCTCC

TTCCACTGCAGCTGCTCGACAGGTTACCGGGCGCCATCTGGTCAACCTGGGCCTTGTGCAG ACATAAATGAGTGTCTGGAAGGCGACTTCTGCTTCCCC

CACGGAGAGTGCCTCAACACTGATGGCTCCTTTACCTGTACCTGTGCCCCTGGCTACCGGCCTGGACCTCGTGGAGCATCTTGTCTGG ACGTGGACGAG

TGCAGCGAAGAGGATCTTTGCCAGAGCGGCATCTGTACCAACACTGACGGCTCCTTCGAGTGCATCTGTCCTCCTGGACACCGCGCTGGCCCTGACCTTG

CCTCCTGCCTTG ACATTGACGAGTGTCGTGAACGGGGACCTGCCCTGTGCGGGTCTCAGCGCTGTGAAAATTCTCCTGGTTCCTACCGCTGTGTGCGGG

ACTGCGATCCAGGTTACCACCCCGGCCCTGAGGGCACCTGTGATG ACATTGATGAGTGCCGAGAATACGGCTCTGCGATTTGTGGTGCCCAGCGCTGTG

AGAACACCCCGGGCTCCTACCGCTGCACACCAGCCTGCGACCCTGGCTATCAGCCTACACCAGGGGGCGGGTGCCAAG ATGTGGATGAATGCCGGAACC

GGTCTTTCTGCGGCGCCCATGCTATGTGCCAGAATCTGCCTGGGTCCTTTCAGTGCGTCTGTGACCAAGGCTACGAAGGGGCACGGGACGGACGTCACTG

CGTGG - UNI1502 - ATGTGAATGAGTGTGAGACACTACAGGGCGTGTGTGGCTCCGCGCTGTGTGAAAATGTTGAAGGCTCCTTCCTGTGTGTCTG

CCCCAATAGCCCTGAGGAATTTGATCCCATGACTGGACGCTGTGTTCCCCCACGGGCTCCTGCAG - UNI11232 - - UNI35715 - GCACGTTC

CCTGGCTCCCAGCCCCAAGCACCTGCCAGCCCCAGTCTTCCAGCCAGGCCACCAGCCCCTCCCCCACCTCGAAGACCCAGCCCTCCCAGGCAGGGTCCCG

TGAGCAGTGGACGTCGCGAGTGCTACTTTGATACAGCCGCTCCAGATGCGTGTGACAATATCTTGGCCCGAAACGTGACGTGGCAGGAGTGCTGCTGTAC

TGTGGGAGAAGGCTGGGGCAGCGGCTGCCGCATCCAACAGTGCCCGGGCACCGAGACAG - UNI11251 - - UNI35715 - CTGAATACCAGTCA

TTGTGTCCTCACGGCCGGGGCTACCTGGTGCCCAGTGGAGACCTGAGTGCCCGGAGAG - UNI17324 - ATGTGGACGAATGCCAACTCTTCCAGGA

CCAGGTGTGCAAGAGCGGAGTGTGTGTGAACACGGCCCCAGGCTACTCTTGCTATTGCAGCAACGGGTTCTACTATCACGCACACAGGCTGGAGTGCGTT

G - UNI10748 - ATAATGACGAATGTGCGGACGAGGAGCCTGCTTGTGAAGGTGGCCGCTGCGTCAACACGGTGGGCTCTTACCACTGTACCTGCGA

GCCCCCACTGGTGCTGGACGGCTCCCGGCGACGCTGCGTCTCCAACGAGAGCCAGAGCCTGG - UNI11243 - - UNI35650 - ATGACAATCTA

GGAGTGTGCTGGCAGGAAGTGGGACCTGATCTCGTCTGCAGTCGCCCACGACTAGACCGGCAGGCCACCTACACCGAGTGCTGCTGTCTCTATGGTGAAG

CCTGGGGTATGGACTGCGCTCTCTGTCCTGCCCAGGACTCAG - UNI35650 - ATGACTTTGAGGCCCTTTGCAATGTGCTGCGTCCACCTGCCTAT

GGCCCGCCGCGCCCTGGTGGCTTTGGAATTCCCTATGAATATGGCCCAGATATAGGCCCACCTTATCAGAGTCTCCCCTATGGGCCAGATCTGTATCCAC

CGCCAGTGCTACCCTACGACCCCTACCCACCCCCACCTGGACCCTTTGCTCGCCGGGAGGCCCCTTATGGCGCCCCACCCTTCGACATGCCGGACTTTGA

GGATGATGGTGGCCCCTATGGCGAGTCTGAGACTCCTGACCCACCTAGCCGAGGCACTGGTTGGCCTTATCGGTCCAGAGACACCCGTGGCTCCTTCCCA

GAGCCTGAGGAATCCTCTGAGCGTGGAAGCTATACAG - UNI13716 - - UNI35650 - GAGCCTTGTCTGAGCCCTATGAGGGCCTAGAGGCCG

AAGAGTGTGGTATCCTGGATGGCTGCCCTCACGGCCGCTGTGTGCGCGTTCCAGAAGGCTTCACCTGCGATTGTTTCGATGGCTACCGCCTGGACATCAC

CCGCATGTCCTGTGTCG - UNI13716 - - UNI21265 - ACGTCAACGAGTGTGATGAGGCAGAGGCAACCTCCCCACTCTGCGTCAATGCGCGC

TGTGTCAACACTGACGGCTCCTTCCGCTGTATCTGTCGTCCAGGATTTGCTCCCACGCATCAGCCACATCACTGTGCGCCTGCTCGACCCCGGGCCTGAG

CAGGGGCGCCAAATCTCCCACTATACCTGAGCACCGGGAGCTTCCAGAGCACGCCTGCCTCCCTCCCTCTAGTCTGCATGTGTGCAAGGATGTCAGACAG

TCTCGACTTAGGATGGACAGACACAGAGGGGTGCCTTCTATGGTGCCAGCCTGTCATGCCCAGTCCCTCCCACCAGTGCCCTGGGCCTGTCCTGGGTCCC

CTGACACATTTCTTGCCCTTTTATACAATTTTCAATTAAAACACCTATTTTGT
Translation
MRRPGLGGPCPLLLLLLLPAATSASGSSPSPSPSPIEKAVVPSHQAG - UNI31843 - GVAACHCCLDQTPKSSRCTRA - UNI24574 - ASCR

VRNCPPAKCTGLEGCLTPTPSVPSPSRSPVEKSQVSLNWQPLT TLQEARALLRQRRPRGPWARALLKRRPPHRAPAGQARV - UNI11249 - - UN

I22426 - VLCPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAMPGLTRSVYTMPLANHRDDEHG - UNI11239 - GVASMVSVHVEH

PQEASVVVHQVERVSGPWEEANPEALARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGSE CASPLPGLRTQEVCCRGEGLAWGVHDCH

PCAEHLR - UNI23644 - RNSNQVSGPNGPCPPGFERVNGSCVD - UNI36327 - DVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSS

CIS - UNI32233 - - UNI36327 - SQHVISEAKGPCYRVLHDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPYGSE - UNI32233 - 

- UNI33544 - - UNI36327 - EGFREICPAGPGYHYSASDLRYNTRPLNQDPPRVTFNQPRVPPATPRPPTG - UNI32233 - - UNI3354

4 - GFLPTRRPEPRPDPGPQPEPRPRPEPRPRPESRPRPEPRPRPEPRPQPESQPRPESRPRPESQPWPEFPLPSIPAWTGPEIPESG - UNI11152

 - - UNI32239 - - UNI33544 - GPSSSMCQRNPQVCGPGRCVPRPSGYTCACDPGFRLGPQGTRCID - UNI32239 - DIDECRRVPTPC

APGRCENTPGSFRCVCGTGFQAGPRATECLD - UNI32239 - DVDECRRVPPPCDRGRCENTPGSFLCVCPAGYQAAPHGASCQD - UNI16474 

- DVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQD DVDECSRSPSPCAYG

RCENTEGSFKCVCPTGFQPNAAGSECED DVDECENRLACPGQECVNSPGSFQCRACPVGHHLHRGRCTD DVDECSSGTPCGLHGQCTNTKGSFHCSCS

TGYRAPSGQPGPCAD DINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLD DVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASC

LD DIDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHPGPEGTCDD DIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQD DVDEC

RNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVD - UNI1502 - DVNECETLQGVCGSALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRAPA

G - UNI11232 - - UNI35715 - GTFPGSQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRRECYFDTAAPDACDNILARNVTWQECCCTVG

EGWGSGCRIQQCPGTETA - UNI11251 - - UNI35715 - AEYQSLCPHGRGYLVPSGDLSARRD - UNI17324 - DVDECQLFQDQVCKSG

VCVNTAPGYSCYCSNGFYYHAHRLECVD - UNI10748 - DNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSRRRCVSNESQSLD - UNI11

243 - - UNI35650 - DDNLGVCWQEVGPDLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSD - UNI35650 - DDFEALCNVLRPPAY

GPPRPGGFGIPYEYGPDIGPPYQSLPYGPDLYPPPVLPYDPYPPPPGPFARREAPYGAPPFDMPDFEDDGGPYGESETPDPPSRGTGWPYRSRDTRGSFP

EPEESSERGSYTG - UNI13716 - - UNI35650 - GALSEPYEGLEAEECGILDGCPHGRCVRVPEGFTCDCFDGYRLDITRMSCVD - UNI13

716 - - UNI21265 - DVNECDEAEATSPLCVNARCVNTDGSFRCICRPGFAPTHQPHHCAPARPRA

For any suggestions or comments, please send an email to unitrap@crg.es