Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040506 (Ambra1)
Chromosomal location
Chr 2: 91570295 - 91759006 (+)
Description
autophagy/beclin 1 regulator 1 Gene [Source:MGI (curated);Acc:Ambra1-001]
RefSeq_dna
NM_172669 NM_001080754 
RefSeq_peptide
NP_766257.3 NP_001074223.1 
UniGene
Mm.436667 
MGI
MGI:2443564 
Uniprot/SWISSPROT
A2AH22 
Human Ortholog
ENSG00000110497 (AMBRA1)
Omim not available
UniTrap UNI1974
Vector Insertion
Chr 2: 91570537 - 91606603
Public Clones AE0537 (sanger) CC0364 (sanger) (sanger) AE0576 (sanger) A003E06 (ggtc)
D031B07 (ggtc) P119B09 (ggtc) M119D03 (ggtc) D102H05 (ggtc) M065C04 (ggtc)
D093H09 (ggtc) P067G05 (ggtc) PST6434-NR (escells) PSTVU01.E20CR (vanderbilt)
IST14286B11 (tigm) IST10545D3 (tigm) IST13192B4 (tigm) IST14208H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24554
Vector Insertion
Chr 2: 91606601 - 91606858
Public Clones not available
Private Clones OST215503 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32912
Vector Insertion
Chr 2: 91609245 - 91611067
Public Clones IST13714H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37880
Vector Insertion
Chr 2: 91613905 - 91645180
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9387
Vector Insertion
Chr 2: 91650367 - 91664616
Public Clones XH189 (baygenomics)
Private Clones OST426599 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6416
Vector Insertion
Chr 2: 91664698 - 91665408
Public Clones CSA014 (baygenomics) W044F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5541
Vector Insertion
Chr 2: 91665510 - 91715872
Public Clones RHA053 (baygenomics) YTA163 (baygenomics) HMA370 (baygenomics) IST10756B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6182
Vector Insertion
Chr 2: 91715984 - 91725757
Public Clones CSG164 (baygenomics) CSD178 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3504
Vector Insertion
Chr 2: 91727136 - 91740654
Public Clones AX0502 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27400
Vector Insertion
Chr 2: 91750547 - 91751570
Public Clones not available
Private Clones OST60623 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045705
Sequence
TTTGATGTCTGGGCGTTCGTGTGTTCGATGATCTTTTGCGGCGTCTTCTTGGTTGATGTCTCCGGAGCGGCGGCGGCTGTGCCAGGTCCTGGACTGAGTT

ATCCCGGAGGCCCCGGGCTCTGGCCGCTTTCTTCCGCTGGTCGGTCGAGCGGACCCCTCGCTTTCTTCGGCCTCTCCCCGCCTTCCGTCCGTGGCTCCGT

GCGCTCGCTGGCTTTCGGGCCGAGCTCTCACTCTCCTCGCAG - UNI1974 - - UNI24554 - ATTTCCATGAGGACAGCTGACAAGGACCTGAA

TGGCCTCATTTTAGCTATTTCTGTGTGTGGAGCTATTGCTTGCTCCTTCAGTTCTGATCCCTGGTGCGACAGTGGCTCCTGAGCACCATGAAAGTTGTCC

CAGAGAAGAATGCTGTACGAATCCTCTGGGGCCGAGAACGGGGCACTCGTGCCATGGGTGCCCAGCGGCTTCTGCAGGAGCTGGTGGAGGATAAGACTCG

ATGGATGAAATGGGAGGGCAAG - UNI24554 - AGAGTAGAACTGCCTGATAGTCCACGCTCGACCTTCTTACTGGCCTTCAGCCCAGACAG GACT

CTCTTGGCATCCACACATGTGAACCATAACATCTATATTACAGAGGTTAAGACTGGCAAGTGTGTTCACTCTCTGATCGGACACCGCCGTACTCCATGGT

GTGTCACTTTTCACCCCACCATCTCAGGCCTTATTGCTTCTGGTTGCCTAGATGGGGAAGTTAGGATTTGGGATTTACAT GGGGGCAGTGAAAGCTGGT

TCACAGACAGCAACAATGCCATAGCCTCCTTGGCTTTCCACCCTACGGCTCAGCTTCTACTAATTGCCACTGCAAATGAGATCCATTTCTGGGATTGGAG

TCGTCGGGAGCCCTTTGCTGTGGTGAAAACAGCCAGTGAGATGGAGCGTGTCCG - UNI32912 - CCTGGTGAGATTTGATCCACTTGGACACTACT

TACTTACAGCTATTGTTAACCCTTCTAATCAGCAG GGTGATGACGAACCAGAAATCCCTATAGATGGAACAGAGTTATCTCATTACCGTCAACGTGCCC

TCCTGCAATCACAGCCAGTTCGCCGGACACCTCTCCTCCACAATTTCCTGCACATGCTGTCCTCCCGTTCCTCTGGCATCCAGGTGGGAGAGCAAAGCAC

AGTACAAGATTCTGCTACCCCCTCACCCCCACCGCCTCCCCCTCAGCCCTCCACGGAGCGTCCCAGGACTTCCGCTTACATCAGACTCCGACAGCGGGTC

AGTTACCCCACCACAGTTGAGTGCTGCCAGCACCCTGGGATCCTGTGCCTTTGCAGCCGCTGTGCTGGCACTCGAGTTCCTTCCCTCTTGCCACACCAGG

ACAGTGTCCCCCCTGCTTCTGCCAGAGCTACTACCCCTTCCTTTTCTTTTGTACAGACCGAGCCCTTCCATCCCCCGGAGCAGGCTTCATCAACGCAGCA

GGACCAGGGCCTCCTGAACCGGCCGTCTGCCTTCAGTACAGTCCAGAGCAGCACTGCGGGCAACACGCTCCGCAACCTCAGTCTGGGTCCTACCCGGCGC

TCTTTGGGGGGCCCTTTGTCTAGCCACCCTTCTAGGTATCACAGAGAACTAGCCCCTGGGCTGACAGGTTCTGAGTGGACCCGGACAGTACTCACTCTGA

ACTCTCGTTCTGAGGTAGAATCTATGCCCCCACCGAGGACCAGTGCCTCCTCAGTGAGTTTGCTTTCTGTACTGAGACAGCAGGAAGGTGGCTCTCAGGC

ATCTGTGTATACTTCAGCCACAGAAGGGAGGGGTTTTCCATCATCAGGGTTGGCAACTGAGTCAGATGGAGGGAATGGTTCCAGCCAAAACAACTCAGGC

AGCATTCGCCATGAGCTTCAATGTGACCTGAGACGCTTCTTTTTGGAGTATGACAGGCTGCAGGAGCTGGATCAGAGCCTGAGTGGGGAAACTCCCCAGA

CCCAACAGGCCCAGGAAATGCTCAACAATAATATTGAATCTGAGAGACCAGGTCCTTCCCACCTGCCTACCCCACACAGCAGTGAGAACAACTCCAACCT

GTCTCGGGGCCACCTTAATCGATGCCGTGCTTGCCATAATCTTCTAACCTTCAACAATGATACCCTTCGTTGGGAAAGAACCACACCTAACTACTCATCT

GGTGAGGCTAGCTCTTCCTGGCACGTCTCCACTACCTTTGAGGGCATGCCACCAAGTGGCAACCAGCTACCACCTCTTGAGCGGACTGAGGGCCAAATGC

CTAGCTCCAGCAGGCTGGAGTTGAGCAGCTCTGCTAGTTCACAAGAGGAGAGGACTGTGGGGGTGGCCTTTAACCAGGAGACAGGCCACTGGGAACGCAT

TTATACCCAGTCCAGCAGATCTGGAACTGTATCACAGGAGGCCTTACATCAAGATATGCCTGAAGAAAGCTCTGAGGAAGACTCCCTCAGGAG GAGGCT

GCTGGAGTCTTCCCTCATTTCATTATCCCGTTATGATGGAGCAGGATCCAGAGAGCACCCAATTTACCCAGACCCAGCGAG ATTATCTCCTGCTGCATA

CTACGCCCAGAGGATGATCCAGTATCTCTCAAGGAGAGACAGTATTCGCCAGCGCTCCATGCGCTACCAACAGAATCGGCTTCGTTCTTCCACCTCCTCT

TCTTCCTCAGACAACCAGGGTCCATCAGTAGAGGGAACCGACTTGGAATTTGAGGACTTTGA - UNI9387 - GGACAATGGTGACAGATCTAGGCAC

CGAGCTCCCCGAAATGCCCGAATGTCTGCACCTTCACTTGGACGATTTGTTCCAAG - UNI6416 - GCGTTTTTTGCTGCCTGAGTACTTGCCTTAT

GCTGGGATTTTTCATGAACGTGGACAGCCTGGCTTGGCTACTCATTCTTCTGTTAACAGGGTCCTGGCAG - UNI5541 - GGGCAGTAATTGGAGAT

GGACAGTCTGCTGTGGCCAGTAACATTGCCAATACTACCTACAGGCTCCAGTGGTGGGACTTCACTAAGTTTGACCTTCCAGAAATCAGTAATG - UNI

6182 - CCTCTGTGAATGTCCTGGTACAGAATTGCAAGATCTACAATGATGCCAGCTGTGACATTTCTGCAGATGGTCAGCTCCTGGCAGCCTTCATCC

CGAGCAGCCAGAGGGGCTTTCCTGATGAAGGCATCCTGGCAGTGTATTCCCTGGCCCCCCATAACTTGGGGGAAATGCTCTACACCAAGCGATTTG GTC

CCAATGCCATTTCTGTAAGCCTGTCCCCGATGGGCCGATACGTTATGGTGGGCTTGGCCTCACGAAGGATCCTACTGCACCCCTCCACAGAGCACATGGT

AGCCCAGGTCTTCAGGCTGCAACAGGCCCATGGTGGTGAGACTTCCATGAGG - UNI3504 - AGAGTTTTCAATGTCCTTTACCCCATGCCTGCAGA

CCAACGGAGACACGTCAGCATCAACTCTGCCCGTTGGCTACCCGAGCCAGGGCTTGGTTTGGCCTATGGCACCAACAAAGGAGACTTGGTGATCTGCCGA

CCAGA GGCCTTAAACTCTGGCATCGAGTACTACTGGGACCAGCTAAGTGAAACAGTCTTCACTGTCCACTCAAGTAGCAGGAGCAGCGAGCGGCCTGG 

- UNI27400 - AACCAGCAGAGCCACGTGGCGGACAGACAGAGACATGGGTTTGATGAATGCAATTGGGCTGCAGCCTCGGAACCCAACCACCTCTGT

GACATCTCAGGGCACCCAGACTCTGGCCCTCCAGTTGCAGAACGCTGAAACACAGACTGAGAGGGAGGAAGAGGAACCAGGGGCAGCATCTTCAGGTCCT

GGTGAAG GCGAGGGCTCAGAATATGGTGGCAGTGGGGAAGATGCCCTCAGCAGGATCCAGAGGCTGATGGCCGAGGGTGGCATGACAGCTGTGGTACAA

CGGGAACAGAGCACCACCATGGCCTCCATGGGTGGCTTTGGCAACAACATCATCGTTAGCCACCGCATTCACCGCAGCTCCCAGACAGGCACAGAGTCAG

GGGCTGCTCGTACCTCCTCACCCCAGCCCTCCACCTCTCGAGGACTGCCATCAGAACCTGGGCAACTGGCAGAGCGAGCGCTAAGCCCCCGGACAGCCTC

CTGGGACCAGCCTAGTACCTCTGGGAGGGAACTACCCCAGCCAGCCCTGTCCTCTTCCTCCCCTGTCCCCATTCCAGTCCCCCTTGCCAGCAATGAGGGA

CCAACCATGCACTGCAATGTGACCAATAACAGTCACCTTCCTGAGGGTGATGGTAGCAACAGGGGGGAAGCTGCAGGCCCTAGTGGAGAGCCACAGAACC

GATAGAGACAAAATGAGGCACTGGTACCTCCCTCAAGCTGCTGAGCAGAAGCAGGACCTCACAGCTGACTGGGAACTGTACACACAGAAGAGCTGATGCC

TGCATCCAGGAACAGGAGGAATGAGAGGGTGGGGCATGGAGCCAGTGGATAAGGGGGCAGTCCAAGGGGCAAGGCTGGCCTGGGGTACTAGAGCCTTCCA

TGATCTAGAGCCCAGAAGAACCACACTGCTGAGCCTGGTGTGAATGAAGAAGCAAGTGGGTGTCTCTGCTATGAACCCCCATTTCTCCTAGGATCACTGG

CCTAGGGGACTCAAACAACCCTGGGCAGAAGCCCCAGAAGAGTAAAGTCTTCCAGATTTAGACCACACCATCCTGGACAGAATGGTGGGACAGTTCTCCC

CTGCCCACTACTGGAGGGACAAGCCACCAGGAGCAGAGGAGCAACACCCCCCCCCCATTGCTTCCATCTCTAAACCTTCCAGAGTTCCAGCCTCTCTCAT

CCTCTTAGCCCACAGAGATGGAAAAGTCAGGCACAGCTTCCATGTCAGTGACTTATGCTCACCAAATGCGGACACCTGTGGAGTGAAGGAAATAGCCTGC

TTGCCTGACACAGAATGGAGTCAATACATGGTGGTGAACAGGTCCTCAGGAGTGGGGGTGTAGGCTGGCCCGCCCCCAGCATGTCCATCAAGCTCCCCCC

TCCACAAGGCCCTCCATGCAGCACCTATGGGTGTCAGTATTACCTAAGCATAGGCCAAAGCCAGCCCAGGGCTGGAGGGAGGAGATTCCAGGTCAGAATG

TGAGGTCTTGGTCTGTGATTTGAGGTGTTGCATGTGGAATCCTGAACTGTACGTGTAGTTTTTAGTGGCGAAATCAAGGCTCTGATCATTTTGTTTTTAG

TATGAAAATGTGATTTCCTTTCTGTTTGTCACTCATCATAGAAACATTGTGGTGGGAGGAGAGGGGATAGTCTACTGCTAATGAGGGAGACACCAAAGAT

CTACATCATTAAAATGATGACACGCCCCTC
Translation
 - UNI1974 - - UNI24554 - MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGK - UNI24554 - RVELPDSPRSTFLLA

FSPDR RTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLH GGSESWFTDSNNAIASLAFHPTAQLLLIATA

NEIHFWDWSRREPFAVVKTASEMERVR - UNI32912 - RLVRFDPLGHYLLTAIVNPSNQQ GDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLLH

NFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTTVECCQHPGILCLCSRCAGTRVPSLLPHQDSVPPASARATTPS

FSFVQTEPFHPPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEWTRTVLTLNSRSEVESMPPPRT

SASSVSLLSVLRQQEGGSQASVYTSATEGRGFPSSGLATESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQAQEMLNNNIES

ERPGPSHLPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWHVSTTFEGMPPSGNQLPPLERTEGQMPSSSRLELSSSASS

QEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRR RRLLESSLISLSRYDGAGSREHPIYPDPAR RLSPAAYYAQRMIQYLS

RRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDFE - UNI9387 - EDNGDRSRHRAPRNARMSAPSLGRFVPR - UNI6416 - RR

FLLPEYLPYAGIFHERGQPGLATHSSVNRVLAG - UNI5541 - GAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNA - UNI6182 - ASV

NVLVQNCKIYNDASCDISADGQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFG GPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQV

FRLQQAHGGETSMR - UNI3504 - RVFNVLYPMPADQRRHVSINSARWLPEPGLGLAYGTNKGDLVICRPE EALNSGIEYYWDQLSETVFTVHSSS

RSSERPG - UNI27400 - GTSRATWRTDRDMGLMNAIGLQPRNPTTSVTSQGTQTLALQLQNAETQTEREEEEPGAASSGPGEG GEGSEYGGSGED

ALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTESGAARTSSPQPSTSRGLPSEPGQLAERALSPRTASWDQPSTSGRELPQP

ALSSSSPVPIPVPLASNEGPTMHCNVTNNSHLPEGDGSNRGEAAGPSGEPQNR
Transcript ENSMUST00000111317
Sequence
TTTGATGTCTGGGCGTTCGTGTGTTCGATGATCTTTTGCGGCGTCTTCTTGGTTGATGTCTCCGGAGCGGCGGCGGCTGTGCCAGGTCCTGGACTGAGTT

ATCCCGGAGGCCCCGGGCTCTGGCCGCTTTCTTCCGCTGGTCGGTCGAGCGGACCCCTCGCTTTCTTCGGCCTCTCCCCGCCTTCCGTCCGTGGCTCCGT

GCGCTCGCTGGCTTTCGGGCCGAGCTCTCACTCTCCTCGCAG - UNI1974 - - UNI24554 - ATTTCCATGAGGACAGCTGACAAGGACCTGAA

TGGCCTCATTTTAGCTATTTCTGTGTGTGGAGCTATTGCTTGCTCCTTCAGTTCTGATCCCTGGTGCGACAGTGGCTCCTGAGCACCATGAAAGTTGTCC

CAGAGAAGAATGCTGTACGAATCCTCTGGGGCCGAGAACGGGGCACTCGTGCCATGGGTGCCCAGCGGCTTCTGCAGGAGCTGGTGGAGGATAAGACTCG

ATGGATGAAATGGGAGGGCAAG - UNI24554 - AGAGTAGAACTGCCTGATAGTCCACGCTCGACCTTCTTACTGGCCTTCAGCCCAGACAG GACT

CTCTTGGCATCCACACATGTGAACCATAACATCTATATTACAGAGGTTAAGACTGGCAAGTGTGTTCACTCTCTGATCGGACACCGCCGTACTCCATGGT

GTGTCACTTTTCACCCCACCATCTCAGGCCTTATTGCTTCTGGTTGCCTAGATGGGGAAGTTAGGATTTGGGATTTACAT GGGGGCAGTGAAAGCTGGT

TCACAGACAGCAACAATGCCATAGCCTCCTTGGCTTTCCACCCTACGGCTCAGCTTCTACTAATTGCCACTGCAAATGAGATCCATTTCTGGGATTGGAG

TCGTCGGGAGCCCTTTGCTGTGGTGAAAACAGCCAGTGAGATGGAGCGTGTCCG - UNI32912 - CCTGGTGAGATTTGATCCACTTGGACACTACT

TACTTACAGCTATTGTTAACCCTTCTAATCAGCAG GGTGATGACGAACCAGAAATCCCTATAGATGGAACAGAGTTATCTCATTACCGTCAACGTGCCC

TCCTGCAATCACAGCCAGTTCGCCGGACACCTCTCCTCCACAATTTCCTGCACATGCTGTCCTCCCGTTCCTCTGGCATCCAGGTGGGAGAGCAAAGCAC

AGTACAAGATTCTGCTACCCCCTCACCCCCACCGCCTCCCCCTCAGCCCTCCACGGAGCGTCCCAGGACTTCCGCTTACATCAGACTCCGACAGCGGGTC

AGTTACCCCACCACAGTTGAGTGCTGCCAGCACCCTGGGATCCTGTGCCTTTGCAGCCGCTGTGCTGGCACTCGAGTTCCTTCCCTCTTGCCACACCAGG

ACAGTGTCCCCCCTGCTTCTGCCAGAGCTACTACCCCTTCCTTTTCTTTTGTACAGACCGAGCCCTTCCATCCCCCGGAGCAGGCTTCATCAACGCAGCA

GGACCAGGGCCTCCTGAACCGGCCGTCTGCCTTCAGTACAGTCCAGAGCAGCACTGCGGGCAACACGCTCCGCAACCTCAGTCTGGGTCCTACCCGGCGC

TCTTTGGGGGGCCCTTTGTCTAGCCACCCTTCTAGGTATCACAGAGAACTAGCCCCTGGGCTGACAGGTTCTGAGTGGACCCGGACAGTACTCACTCTGA

ACTCTCGTTCTGAGGTAGAATCTATGCCCCCACCGAGGACCAGTGCCTCCTCAGTGAGTTTGCTTTCTGTACTGAGACAGCAGGAAGGTGGCTCTCAGGC

ATCTGTGTATACTTCAGCCACAGAAGGGAGGGGTTTTCCATCATCAGGGTTGGCAACTGAGTCAGATGGAGGGAATGGTTCCAGCCAAAACAACTCAGGC

AGCATTCGCCATGAGCTTCAATGTGACCTGAGACGCTTCTTTTTGGAGTATGACAGGCTGCAGGAGCTGGATCAGAGCCTGAGTGGGGAAACTCCCCAGA

CCCAACAGGCCCAGGAAATGCTCAACAATAATATTGAATCTGAGAGACCAGGTCCTTCCCACCTGCCTACCCCACACAGCAGTGAGAACAACTCCAACCT

GTCTCGGGGCCACCTTAATCGATGCCGTGCTTGCCATAATCTTCTAACCTTCAACAATGATACCCTTCGTTGGGAAAGAACCACACCTAACTACTCATCT

GGTGAGGCTAGCTCTTCCTGGCACGTCTCCACTACCTTTGAGGGCATGCCACCAAGTGGCAACCAGCTACCACCTCTTGAGCGGACTGAGGGCCAAATGC

CTAGCTCCAGCAGGCTGGAGTTGAGCAGCTCTGCTAGTTCACAAGAGGAGAGGACTGTGGGGGTGGCCTTTAACCAGGAGACAGGCCACTGGGAACGCAT

TTATACCCAGTCCAGCAGATCTGGAACTGTATCACAGGAGGCCTTACATCAAGATATGCCTGAAGAAAGCTCTGAGGAAGACTCCCTCAGGAG ATTATC

TCCTGCTGCATACTACGCCCAGAGGATGATCCAGTATCTCTCAAGGAGAGACAGTATTCGCCAGCGCTCCATGCGCTACCAACAGAATCGGCTTCGTTCT

TCCACCTCCTCTTCTTCCTCAGACAACCAGGGTCCATCAGTAGAGGGAACCGACTTGGAATTTGAGGACTTTGA - UNI9387 - GGACAATGGTGAC

AGATCTAGGCACCGAGCTCCCCGAAATGCCCGAATGTCTGCACCTTCACTTGGACGATTTGTTCCAAG - UNI6416 - GCGTTTTTTGCTGCCTGAG

TACTTGCCTTATGCTGGGATTTTTCATGAACGTGGACAGCCTGGCTTGGCTACTCATTCTTCTGTTAACAGGGTCCTGGCAG - UNI5541 - GGGCA

GTAATTGGAGATGGACAGTCTGCTGTGGCCAGTAACATTGCCAATACTACCTACAGGCTCCAGTGGTGGGACTTCACTAAGTTTGACCTTCCAGAAATCA

GTAATG - UNI6182 - CCTCTGTGAATGTCCTGGTACAGAATTGCAAGATCTACAATGATGCCAGCTGTGACATTTCTGCAGATGGTCAGCTCCTGG

CAGCCTTCATCCCGAGCAGCCAGAGGGGCTTTCCTGATGAAGGCATCCTGGCAGTGTATTCCCTGGCCCCCCATAACTTGGGGGAAATGCTCTACACCAA

GCGATTTG GTCCCAATGCCATTTCTGTAAGCCTGTCCCCGATGGGCCGATACGTTATGGTGGGCTTGGCCTCACGAAGGATCCTACTGCACCCCTCCAC

AGAGCACATGGTAGCCCAGGTCTTCAGGCTGCAACAGGCCCATGGTGGTGAGACTTCCATGAGG - UNI3504 - AGAGTTTTCAATGTCCTTTACCC

CATGCCTGCAGACCAACGGAGACACGTCAGCATCAACTCTGCCCGTTGGCTACCCGAGCCAGGGCTTGGTTTGGCCTATGGCACCAACAAAGGAGACTTG

GTGATCTGCCGACCAGA GGCCTTAAACTCTGGCATCGAGTACTACTGGGACCAGCTAAGTGAAACAGTCTTCACTGTCCACTCAAGTAGCAGGAGCAGC

GAGCGGCCTGG - UNI27400 - AACCAGCAGAGCCACGTGGCGGACAGACAGAGACATGGGTTTGATGAATGCAATTGGGCTGCAGCCTCGGAACCC

AACCACCTCTGTGACATCTCAGGGCACCCAGACTCTGGCCCTCCAGTTGCAGAACGCTGAAACACAGACTGAGAGGGAGGAAGAGGAACCAGGGGCAGCA

TCTTCAGGTCCTGGTGAAG GCGAGGGCTCAGAATATGGTGGCAGTGGGGAAGATGCCCTCAGCAGGATCCAGAGGCTGATGGCCGAGGGTGGCATGACA

GCTGTGGTACAACGGGAACAGAGCACCACCATGGCCTCCATGGGTGGCTTTGGCAACAACATCATCGTTAGCCACCGCATTCACCGCAGCTCCCAGACAG

GCACAGAGTCAGGGGCTGCTCGTACCTCCTCACCCCAGCCCTCCACCTCTCGAGGACTGCCATCAGAACCTGGGCAACTGGCAGAGCGAGCGCTAAGCCC

CCGGACAGCCTCCTGGGACCAGCCTAGTACCTCTGGGAGGGAACTACCCCAGCCAGCCCTGTCCTCTTCCTCCCCTGTCCCCATTCCAGTCCCCCTTGCC

AGCAATGAGGGACCAACCATGCACTGCAATGTGACCAATAACAGTCACCTTCCTGAGGGTGATGGTAGCAACAGGGGGGAAGCTGCAGGCCCTAGTGGAG

AGCCACAGAACCGATAGAGACAAAATGAGGCACTGGTACCTCCCTCAAGCTGCTGAGCAGAAGCAGGACCTCACAGCTGACTGGGAACTGTACACACAGA

AGAGCTGATGCCTGCATCCAGGAACAGGAGGAATGAGAGGGTGGGGCATGGAGCCAGTGGATAAGGGGGCAGTCCAAGGGGCAAGGCTGGCCTGGGGTAC

TAGAGCCTTCCATGATCTAGAGCCCAGAAGAACCACACTGCTGAGCCTGGTGTGAATGAAGAAGCAAGTGGGTGTCTCTGCTATGAACCCCCATTTCTCC

TAGGATCACTGGCCTAGGGGACTCAAACAACCCTGGGCAGAAGCCCCAGAAGAGTAAAGTCTTCCAGATTTAGACCACACCATCCTGGACAGAATGGTGG

GACAGTTCTCCCCTGCCCACTACTGGAGGGACAAGCCACCAGGAGCAGAGGAGCAACACCCCCCCCCCATTGCTTCCATCTCTAAACCTTCCAGAGTTCC

AGCCTCTCTCATCCTCTTAGCCCACAGAGATGGAAAAGTCAGGCACAGCTTCCATGTCAGTGACTTATGCTCACCAAATGCGGACACCTGTGGAGTGAAG

GAAATAGCCTGCTTGCCTGACACAGAATGGAGTCAATACATGGTGGTGAACAGGTCCTCAGGAGTGGGGGTGTAGGCTGGCCCGCCCCCAGCATGTCCAT

CAAGCTCCCCCCTCCACAAGGCCCTCCATGCAGCACCTATGGGTGTCAGTATTACCTAAGCATAGGCCAAAGCCAGCCCAGGGCTGGAGGGAGGAGATTC

CAGGTCAGAATGTGAGGTCTTGGTCTGTGATTTGAGGTGTTGCATGTGGAATCCTGAACTGTACGTGTAGTTTTTAGTGGCGAAATCAAGGCTCTGATCA

TTTTGTTTTTAGTATGAAAATGTGATTTCCTTTCTGTTTGTCACTCATCATAGAAACATTGTGGTGGGAGGAGAGGGGATAGTCTACTGCTAATGAGGGA

GACACCAAAGATCTACATCATTAAAATGATGACACGCCCCTC
Translation
 - UNI1974 - - UNI24554 - MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGK - UNI24554 - RVELPDSPRSTFLLA

FSPDR RTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLH GGSESWFTDSNNAIASLAFHPTAQLLLIATA

NEIHFWDWSRREPFAVVKTASEMERVR - UNI32912 - RLVRFDPLGHYLLTAIVNPSNQQ GDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLLH

NFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTTVECCQHPGILCLCSRCAGTRVPSLLPHQDSVPPASARATTPS

FSFVQTEPFHPPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEWTRTVLTLNSRSEVESMPPPRT

SASSVSLLSVLRQQEGGSQASVYTSATEGRGFPSSGLATESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQAQEMLNNNIES

ERPGPSHLPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWHVSTTFEGMPPSGNQLPPLERTEGQMPSSSRLELSSSASS

QEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRR RLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGP

SVEGTDLEFEDFE - UNI9387 - EDNGDRSRHRAPRNARMSAPSLGRFVPR - UNI6416 - RRFLLPEYLPYAGIFHERGQPGLATHSSVNRVL

AG - UNI5541 - GAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNA - UNI6182 - ASVNVLVQNCKIYNDASCDISADGQLLAAFIPSS

QRGFPDEGILAVYSLAPHNLGEMLYTKRFG GPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQVFRLQQAHGGETSMR - UNI3504 - RVFN

VLYPMPADQRRHVSINSARWLPEPGLGLAYGTNKGDLVICRPE EALNSGIEYYWDQLSETVFTVHSSSRSSERPG - UNI27400 - GTSRATWRTD

RDMGLMNAIGLQPRNPTTSVTSQGTQTLALQLQNAETQTEREEEEPGAASSGPGEG GEGSEYGGSGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGG

FGNNIIVSHRIHRSSQTGTESGAARTSSPQPSTSRGLPSEPGQLAERALSPRTASWDQPSTSGRELPQPALSSSSPVPIPVPLASNEGPTMHCNVTNNSH

LPEGDGSNRGEAAGPSGEPQNR
Transcript ENSMUST00000111316
Sequence
TTTGATGTCTGGGCGTTCGTGTGTTCGATGATCTTTTGCGGCGTCTTCTTGGTTGATGTCTCCGGAGCGGCGGCGGCTGTGCCAGGTCCTGGACTGAGTT

ATCCCGGAGGCCCCGGGCTCTGGCCGCTTTCTTCCGCTGGTCGGTCGAGCGGACCCCTCGCTTTCTTCGGCCTCTCCCCGCCTTCCGTCCGTGGCTCCGT

GCGCTCGCTGGCTTTCGGGCCGAGCTCTCACTCTCCTCGCAG - UNI1974 - - UNI24554 - ATTTCCATGAGGACAGCTGACAAGGACCTGAA

TGGCCTCATTTTAGCTATTTCTGTGTGTGGAGCTATTGCTTGCTCCTTCAGTTCTGATCCCTGGTGCGACAGTGGCTCCTGAGCACCATGAAAGTTGTCC

CAGAGAAGAATGCTGTACGAATCCTCTGGGGCCGAGAACGGGGCACTCGTGCCATGGGTGCCCAGCGGCTTCTGCAGGAGCTGGTGGAGGATAAGACTCG

ATGGATGAAATGGGAGGGCAAG - UNI24554 - AGAGTAGAACTGCCTGATAGTCCACGCTCGACCTTCTTACTGGCCTTCAGCCCAGACAG GACT

CTCTTGGCATCCACACATGTGAACCATAACATCTATATTACAGAGGTTAAGACTGGCAAGTGTGTTCACTCTCTGATCGGACACCGCCGTACTCCATGGT

GTGTCACTTTTCACCCCACCATCTCAGGCCTTATTGCTTCTGGTTGCCTAGATGGGGAAGTTAGGATTTGGGATTTACAT GGGGGCAGTGAAAGCTGGT

TCACAGACAGCAACAATGCCATAGCCTCCTTGGCTTTCCACCCTACGGCTCAGCTTCTACTAATTGCCACTGCAAATGAGATCCATTTCTGGGATTGGAG

TCGTCGGGAGCCCTTTGCTGTGGTGAAAACAGCCAGTGAGATGGAGCGTGTCCG - UNI32912 - CCTGGTGAGATTTGATCCACTTGGACACTACT

TACTTACAGCTATTGTTAACCCTTCTAATCAGCAG GGTGATGACGAACCAGAAATCCCTATAGATGGAACAGAGTTATCTCATTACCGTCAACGTGCCC

TCCTGCAATCACAGCCAGTTCGCCGGACACCTCTCCTCCACAATTTCCTGCACATGCTGTCCTCCCGTTCCTCTGGCATCCAGGTGGGAGAGCAAAGCAC

AGTACAAGATTCTGCTACCCCCTCACCCCCACCGCCTCCCCCTCAGCCCTCCACGGAGCGTCCCAGGACTTCCGCTTACATCAGACTCCGACAGCGGGTC

AGTTACCCCACCACAGTTGAGTGCTGCCAGCACCCTGGGATCCTGTGCCTTTGCAGCCGCTGTGCTGGCACTCGAGTTCCTTCCCTCTTGCCACACCAGG

ACAGTGTCCCCCCTGCTTCTGCCAGAGCTACTACCCCTTCCTTTTCTTTTGTACAGACCGAGCCCTTCCATCCCCCGGAGCAGGCTTCATCAACGCAGCA

GGACCAGGGCCTCCTGAACCGGCCGTCTGCCTTCAGTACAGTCCAGAGCAGCACTGCGGGCAACACGCTCCGCAACCTCAGTCTGGGTCCTACCCGGCGC

TCTTTGGGGGGCCCTTTGTCTAGCCACCCTTCTAGGTATCACAGAGAACTAGCCCCTGGGCTGACAGGTTCTGAGTGGACCCGGACAGTACTCACTCTGA

ACTCTCGTTCTGAGGTAGAATCTATGCCCCCACCGAGGACCAGTGCCTCCTCAGTGAGTTTGCTTTCTGTACTGAGACAGCAGGAAGGTGGCTCTCAGGC

ATCTGTGTATACTTCAGCCACAGAAGGGAGGGGTTTTCCATCATCAGGGTTGGCAACTGAGTCAGATGGAGGGAATGGTTCCAGCCAAAACAACTCAGGC

AGCATTCGCCATGAGCTTCAATGTGACCTGAGACGCTTCTTTTTGGAGTATGACAGGCTGCAGGAGCTGGATCAGAGCCTGAGTGGGGAAACTCCCCAGA

CCCAACAGGCCCAGGAAATGCTCAACAATAATATTGAATCTGAGAGACCAGGTCCTTCCCACCTGCCTACCCCACACAGCAGTGAGAACAACTCCAACCT

GTCTCGGGGCCACCTTAATCGATGCCGTGCTTGCCATAATCTTCTAACCTTCAACAATGATACCCTTCGTTGGGAAAGAACCACACCTAACTACTCATCT

GGTGAGGCTAGCTCTTCCTGGCACGTCTCCACTACCTTTGAGGGCATGCCACCAAGTGGCAACCAGCTACCACCTCTTGAGCGGACTGAGGGCCAAATGC

CTAGCTCCAGCAGGCTGGAGTTGAGCAGCTCTGCTAGTTCACAAGAGGAGAGGACTGTGGGGGTGGCCTTTAACCAGGAGACAGGCCACTGGGAACGCAT

TTATACCCAGTCCAGCAGATCTGGAACTGTATCACAGGAGGCCTTACATCAAGATATGCCTGAAGAAAGCTCTGAGGAAGACTCCCTCAGGAG GAGGCT

GCTGGAGTCTTCCCTCATTTCATTATCCCGTTATGATGGAGCAGGATCCAGAGAGCACCCAATTTACCCAGACCCAGCGAG - UNI9387 - GGACAA

TGGTGACAGATCTAGGCACCGAGCTCCCCGAAATGCCCGAATGTCTGCACCTTCACTTGGACGATTTGTTCCAAG - UNI6416 - GCGTTTTTTGCT

GCCTGAGTACTTGCCTTATGCTGGGATTTTTCATGAACGTGGACAGCCTGGCTTGGCTACTCATTCTTCTGTTAACAGGGTCCTGGCAG - UNI5541 

- GGGCAGTAATTGGAGATGGACAGTCTGCTGTGGCCAGTAACATTGCCAATACTACCTACAGGCTCCAGTGGTGGGACTTCACTAAGTTTGACCTTCCA

GAAATCAGTAATG - UNI6182 - CCTCTGTGAATGTCCTGGTACAGAATTGCAAGATCTACAATGATGCCAGCTGTGACATTTCTGCAGATGGTCAG

CTCCTGGCAGCCTTCATCCCGAGCAGCCAGAGGGGCTTTCCTGATGAAGGCATCCTGGCAGTGTATTCCCTGGCCCCCCATAACTTGGGGGAAATGCTCT

ACACCAAGCGATTTG GTCCCAATGCCATTTCTGTAAGCCTGTCCCCGATGGGCCGATACGTTATGGTGGGCTTGGCCTCACGAAGGATCCTACTGCACC

CCTCCACAGAGCACATGGTAGCCCAGGTCTTCAGGCTGCAACAGGCCCATGGTGGTGAGACTTCCATGAGG - UNI3504 - AGAGTTTTCAATGTCC

TTTACCCCATGCCTGCAGACCAACGGAGACACGTCAGCATCAACTCTGCCCGTTGGCTACCCGAGCCAGGGCTTGGTTTGGCCTATGGCACCAACAAAGG

AGACTTGGTGATCTGCCGACCAGA GGCCTTAAACTCTGGCATCGAGTACTACTGGGACCAGCTAAGTGAAACAGTCTTCACTGTCCACTCAAGTAGCAG

GAGCAGCGAGCGGCCTGG - UNI27400 - AACCAGCAGAGCCACGTGGCGGACAGACAGAGACATGGGTTTGATGAATGCAATTGGGCTGCAGCCTC

GGAACCCAACCACCTCTGTGACATCTCAGGGCACCCAGACTCTGGCCCTCCAGTTGCAGAACGCTGAAACACAGACTGAGAGGGAGGAAGAGGAACCAGG

GGCAGCATCTTCAGGTCCTGGTGAAG GCGAGGGCTCAGAATATGGTGGCAGTGGGGAAGATGCCCTCAGCAGGATCCAGAGGCTGATGGCCGAGGGTGG

CATGACAGCTGTGGTACAACGGGAACAGAGCACCACCATGGCCTCCATGGGTGGCTTTGGCAACAACATCATCGTTAGCCACCGCATTCACCGCAGCTCC

CAGACAGGCACAGAGTCAGGGGCTGCTCGTACCTCCTCACCCCAGCCCTCCACCTCTCGAGGACTGCCATCAGAACCTGGGCAACTGGCAGAGCGAGCGC

TAAGCCCCCGGACAGCCTCCTGGGACCAGCCTAGTACCTCTGGGAGGGAACTACCCCAGCCAGCCCTGTCCTCTTCCTCCCCTGTCCCCATTCCAGTCCC

CCTTGCCAGCAATGAGGGACCAACCATGCACTGCAATGTGACCAATAACAGTCACCTTCCTGAGGGTGATGGTAGCAACAGGGGGGAAGCTGCAGGCCCT

AGTGGAGAGCCACAGAACCGATAGAGACAAAATGAGGCACTGGTACCTCCCTCAAGCTGCTGAGCAGAAGCAGGACCTCACAGCTGACTGGGAACTGTAC

ACACAGAAGAGCTGATGCCTGCATCCAGGAACAGGAGGAATGAGAGGGTGGGGCATGGAGCCAGTGGATAAGGGGGCAGTCCAAGGGGCAAGGCTGGCCT

GGGGTACTAGAGCCTTCCATGATCTAGAGCCCAGAAGAACCACACTGCTGAGCCTGGTGTGAATGAAGAAGCAAGTGGGTGTCTCTGCTATGAACCCCCA

TTTCTCCTAGGATCACTGGCCTAGGGGACTCAAACAACCCTGGGCAGAAGCCCCAGAAGAGTAAAGTCTTCCAGATTTAGACCACACCATCCTGGACAGA

ATGGTGGGACAGTTCTCCCCTGCCCACTACTGGAGGGACAAGCCACCAGGAGCAGAGGAGCAACACCCCCCCCCCATTGCTTCCATCTCTAAACCTTCCA

GAGTTCCAGCCTCTCTCATCCTCTTAGCCCACAGAGATGGAAAAGTCAGGCACAGCTTCCATGTCAGTGACTTATGCTCACCAAATGCGGACACCTGTGG

AGTGAAGGAAATAGCCTGCTTGCCTGACACAGAATGGAGTCAATACATGGTGGTGAACAGGTCCTCAGGAGTGGGGGTGTAGGCTGGCCCGCCCCCAGCA

TGTCCATCAAGCTCCCCCCTCCACAAGGCCCTCCATGCAGCACCTATGGGTGTCAGTATTACCTAAGCATAGGCCAAAGCCAGCCCAGGGCTGGAGGGAG

GAGATTCCAGGTCAGAATGTGAGGTCTTGGTCTGTGATTTGAGGTGTTGCATGTGGAATCCTGAACTGTACGTGTAGTTTTTAGTGGCGAAATCAAGGCT

CTGATCATTTTGTTTTTAGTATGAAAATGTGATTTCCTTTCTGTTTGTCACTCATCATAGAAACATTGTGGTGGGAGGAGAGGGGATAGTCTACTGCTAA

TGAGGGAGACACCAAAGATCTACATCATTAAAATGATGACACGCCCCTC
Translation
 - UNI1974 - - UNI24554 - MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGK - UNI24554 - RVELPDSPRSTFLLA

FSPDR RTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLH GGSESWFTDSNNAIASLAFHPTAQLLLIATA

NEIHFWDWSRREPFAVVKTASEMERVR - UNI32912 - RLVRFDPLGHYLLTAIVNPSNQQ GDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLLH

NFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTTVECCQHPGILCLCSRCAGTRVPSLLPHQDSVPPASARATTPS

FSFVQTEPFHPPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEWTRTVLTLNSRSEVESMPPPRT

SASSVSLLSVLRQQEGGSQASVYTSATEGRGFPSSGLATESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQAQEMLNNNIES

ERPGPSHLPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWHVSTTFEGMPPSGNQLPPLERTEGQMPSSSRLELSSSASS

QEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRR RRLLESSLISLSRYDGAGSREHPIYPDPAR - UNI9387 - RDNGD

RSRHRAPRNARMSAPSLGRFVPR - UNI6416 - RRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLAG - UNI5541 - GAVIGDGQSAVASNIA

NTTYRLQWWDFTKFDLPEISNA - UNI6182 - ASVNVLVQNCKIYNDASCDISADGQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFG 

GPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQVFRLQQAHGGETSMR - UNI3504 - RVFNVLYPMPADQRRHVSINSARWLPEPGLGLAYG

TNKGDLVICRPE EALNSGIEYYWDQLSETVFTVHSSSRSSERPG - UNI27400 - GTSRATWRTDRDMGLMNAIGLQPRNPTTSVTSQGTQTLALQ

LQNAETQTEREEEEPGAASSGPGEG GEGSEYGGSGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTESGAARTSSPQP

STSRGLPSEPGQLAERALSPRTASWDQPSTSGRELPQPALSSSSPVPIPVPLASNEGPTMHCNVTNNSHLPEGDGSNRGEAAGPSGEPQNR
Transcript ENSMUST00000099712
Sequence
TTTGATGTCTGGGCGTTCGTGTGTTCGATGATCTTTTGCGGCGTCTTCTTGGTTGATGTCTCCGGAGCGGCGGCGGCTGTGCCAGGTCCTGGACTGAGTT

ATCCCGGAGGCCCCGGGCTCTGGCCGCTTTCTTCCGCTGGTCGGTCGAGCGGACCCCTCGCTTTCTTCGGCCTCTCCCCGCCTTCCGTCCGTGGCTCCGT

GCGCTCGCTGGCTTTCGGGCCGAGCTCTCACTCTCCTCGCAG - UNI1974 - - UNI24554 - ATTTCCATGAGGACAGCTGACAAGGACCTGAA

TGGCCTCATTTTAGCTATTTCTGTGTGTGGAGCTATTGCTTGCTCCTTCAGTTCTGATCCCTGGTGCGACAGTGGCTCCTGAGCACCATGAAAGTTGTCC

CAGAGAAGAATGCTGTACGAATCCTCTGGGGCCGAGAACGGGGCACTCGTGCCATGGGTGCCCAGCGGCTTCTGCAGGAGCTGGTGGAGGATAAGACTCG

ATGGATGAAATGGGAGGGCAAG - UNI24554 - AGAGTAGAACTGCCTGATAGTCCACGCTCGACCTTCTTACTGGCCTTCAGCCCAGACAG GACT

CTCTTGGCATCCACACATGTGAACCATAACATCTATATTACAGAGGTTAAGACTGGCAAGTGTGTTCACTCTCTGATCGGACACCGCCGTACTCCATGGT

GTGTCACTTTTCACCCCACCATCTCAGGCCTTATTGCTTCTGGTTGCCTAGATGGGGAAGTTAGGATTTGGGATTTACAT GGGGGCAGTGAAAGCTGGT

TCACAGACAGCAACAATGCCATAGCCTCCTTGGCTTTCCACCCTACGGCTCAGCTTCTACTAATTGCCACTGCAAATGAGATCCATTTCTGGGATTGGAG

TCGTCGGGAGCCCTTTGCTGTGGTGAAAACAGCCAGTGAGATGGAGCGTGTCCG - UNI32912 - CCTGGTGAGATTTGATCCACTTGGACACTACT

TACTTACAGCTATTGTTAACCCTTCTAATCAGCAG GGTGATGACGAACCAGAAATCCCTATAGATGGAACAGAGTTATCTCATTACCGTCAACGTGCCC

TCCTGCAATCACAGCCAGTTCGCCGGACACCTCTCCTCCACAATTTCCTGCACATGCTGTCCTCCCGTTCCTCTGGCATCCAG ACCGAGCCCTTCCATC

CCCCGGAGCAGGCTTCATCAACGCAGCAGGACCAGGGCCTCCTGAACCGGCCGTCTGCCTTCAGTACAGTCCAGAGCAGCACTGCGGGCAACACGCTCCG

CAACCTCAGTCTGGGTCCTACCCGGCGCTCTTTGGGGGGCCCTTTGTCTAGCCACCCTTCTAGGTATCACAGAGAACTAGCCCCTGGGCTGACAGGTTCT

GAGTGGACCCGGACAGTACTCACTCTGAACTCTCGTTCTGAGGTAGAATCTATGCCCCCACCGAGGACCAGTGCCTCCTCAGTGAGTTTGCTTTCTGTAC

TGAGACAGCAGGAAGGTGGCTCTCAGGCATCTGTGTATACTTCAGCCACAGAAGGGAGGGGTTTTCCATCATCAGGGTTGGCAACTGAGTCAGATGGAGG

GAATGGTTCCAGCCAAAACAACTCAGGCAGCATTCGCCATGAGCTTCAATGTGACCTGAGACGCTTCTTTTTGGAGTATGACAGGCTGCAGGAGCTGGAT

CAGAGCCTGAGTGGGGAAACTCCCCAGACCCAACAGGCCCAGGAAATGCTCAACAATAATATTGAATCTGAGAGACCAGGTCCTTCCCACCTGCCTACCC

CACACAGCAGTGAGAACAACTCCAACCTGTCTCGGGGCCACCTTAATCGATGCCGTGCTTGCCATAATCTTCTAACCTTCAACAATGATACCCTTCGTTG

GGAAAGAACCACACCTAACTACTCATCTGGTGAGGCTAGCTCTTCCTGGCACGTCTCCACTACCTTTGAGGGCATGCCACCAAGTGGCAACCAGCTACCA

CCTCTTGAGCGGACTGAGGGCCAAATGCCTAGCTCCAGCAGGCTGGAGTTGAGCAGCTCTGCTAGTTCACAAGAGGAGAGGACTGTGGGGGTGGCCTTTA

ACCAGGAGACAGGCCACTGGGAACGCATTTATACCCAGTCCAGCAGATCTGGAACTGTATCACAGGAGGCCTTACATCAAGATATGCCTGAAGAAAGCTC

TGAGGAAGACTCCCTCAGGAG GAGGCTGCTGGAGTCTTCCCTCATTTCATTATCCCGTTATGATGGAGCAGGATCCAGAGAGCACCCAATTTACCCAGA

CCCAGCGAG ATTATCTCCTGCTGCATACTACGCCCAGAGGATGATCCAGTATCTCTCAAGGAGAGACAGTATTCGCCAGCGCTCCATGCGCTACCAACA

GAATCGGCTTCGTTCTTCCACCTCCTCTTCTTCCTCAGACAACCAGGGTCCATCAGTAGAGGGAACCGACTTGGAATTTGAGGACTTTGA - UNI9387

 - GGACAATGGTGACAGATCTAGGCACCGAGCTCCCCGAAATGCCCGAATGTCTGCACCTTCACTTGGACGATTTGTTCCAAG - UNI6416 - GCG

TTTTTTGCTGCCTGAGTACTTGCCTTATGCTGGGATTTTTCATGAACGTGGACAGCCTGGCTTGGCTACTCATTCTTCTGTTAACAGGGTCCTGGCAG -

 UNI5541 - GGGCAGTAATTGGAGATGGACAGTCTGCTGTGGCCAGTAACATTGCCAATACTACCTACAGGCTCCAGTGGTGGGACTTCACTAAGTTT

GACCTTCCAGAAATCAGTAATG - UNI6182 - CCTCTGTGAATGTCCTGGTACAGAATTGCAAGATCTACAATGATGCCAGCTGTGACATTTCTGCA

GATGGTCAGCTCCTGGCAGCCTTCATCCCGAGCAGCCAGAGGGGCTTTCCTGATGAAGGCATCCTGGCAGTGTATTCCCTGGCCCCCCATAACTTGGGGG

AAATGCTCTACACCAAGCGATTTG GTCCCAATGCCATTTCTGTAAGCCTGTCCCCGATGGGCCGATACGTTATGGTGGGCTTGGCCTCACGAAGGATCC

TACTGCACCCCTCCACAGAGCACATGGTAGCCCAGGTCTTCAGGCTGCAACAGGCCCATGGTGGTGAGACTTCCATGAGG - UNI3504 - AGAGTTT

TCAATGTCCTTTACCCCATGCCTGCAGACCAACGGAGACACGTCAGCATCAACTCTGCCCGTTGGCTACCCGAGCCAGGGCTTGGTTTGGCCTATGGCAC

CAACAAAGGAGACTTGGTGATCTGCCGACCAGA GGCCTTAAACTCTGGCATCGAGTACTACTGGGACCAGCTAAGTGAAACAGTCTTCACTGTCCACTC

AAGTAGCAGGAGCAGCGAGCGGCCTGG - UNI27400 - AACCAGCAGAGCCACGTGGCGGACAGACAGAGACATGGGTTTGATGAATGCAATTGGGC

TGCAGCCTCGGAACCCAACCACCTCTGTGACATCTCAGGGCACCCAGACTCTGGCCCTCCAGTTGCAGAACGCTGAAACACAGACTGAGAGGGAGGAAGA

GGAACCAGGGGCAGCATCTTCAGGTCCTGGTGAAG GCGAGGGCTCAGAATATGGTGGCAGTGGGGAAGATGCCCTCAGCAGGATCCAGAGGCTGATGGC

CGAGGGTGGCATGACAGCTGTGGTACAACGGGAACAGAGCACCACCATGGCCTCCATGGGTGGCTTTGGCAACAACATCATCGTTAGCCACCGCATTCAC

CGCAGCTCCCAGACAGGCACAGAGTCAGGGGCTGCTCGTACCTCCTCACCCCAGCCCTCCACCTCTCGAGGACTGCCATCAGAACCTGGGCAACTGGCAG

AGCGAGCGCTAAGCCCCCGGACAGCCTCCTGGGACCAGCCTAGTACCTCTGGGAGGGAACTACCCCAGCCAGCCCTGTCCTCTTCCTCCCCTGTCCCCAT

TCCAGTCCCCCTTGCCAGCAATGAGGGACCAACCATGCACTGCAATGTGACCAATAACAGTCACCTTCCTGAGGGTGATGGTAGCAACAGGGGGGAAGCT

GCAGGCCCTAGTGGAGAGCCACAGAACCGATAGAGACAAAATGAGGCACTGGTACCTCCCTCAAGCTGCTGAGCAGAAGCAGGACCTCACAGCTGACTGG

GAACTGTACACACAGAAGAGCTGATGCCTGCATCCAGGAACAGGAGGAATGAGAGGGTGGGGCATGGAGCCAGTGGATAAGGGGGCAGTCCAAGGGGCAA

GGCTGGCCTGGGGTACTAGAGCCTTCCATGATCTAGAGCCCAGAAGAACCACACTGCTGAGCCTGGTGTGAATGAAGAAGCAAGTGGGTGTCTCTGCTAT

GAACCCCCATTTCTCCTAGGATCACTGGCCTAGGGGACTCAAACAACCCTGGGCAGAAGCCCCAGAAGAGTAAAGTCTTCCAGATTTAGACCACACCATC

CTGGACAGAATGGTGGGACAGTTCTCCCCTGCCCACTACTGGAGGGACAAGCCACCAGGAGCAGAGGAGCAACACCCCCCCCCCATTGCTTCCATCTCTA

AACCTTCCAGAGTTCCAGCCTCTCTCATCCTCTTAGCCCACAGAGATGGAAAAGTCAGGCACAGCTTCCATGTCAGTGACTTATGCTCACCAAATGCGGA

CACCTGTGGAGTGAAGGAAATAGCCTGCTTGCCTGACACAGAATGGAGTCAATACATGGTGGTGAACAGGTCCTCAGGAGTGGGGGTGTAGGCTGGCCCG

CCCCCAGCATGTCCATCAAGCTCCCCCCTCCACAAGGCCCTCCATGCAGCACCTATGGGTGTCAGTATTACCTAAGCATAGGCCAAAGCCAGCCCAGGGC

TGGAGGGAGGAGATTCCAGGTCAGAATGTGAGGTCTTGGTCTGTGATTTGAGGTGTTGCATGTGGAATCCTGAACTGTACGTGTAGTTTTTAGTGGCGAA

ATCAAGGCTCTGATCATTTTGTTTTTAGTATGAAAATGTGATTTCCTTTCTGTTTGTCACTCATCATAGAAACATTGTGGTGGGAGGAGAGGGGATAGTC

TACTGCTAATGAGGGAGACACCAAAGATCTACATCATTAAAATGATGACACGCCCCTC
Translation
 - UNI1974 - - UNI24554 - MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGK - UNI24554 - RVELPDSPRSTFLLA

FSPDR RTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLH GGSESWFTDSNNAIASLAFHPTAQLLLIATA

NEIHFWDWSRREPFAVVKTASEMERVR - UNI32912 - RLVRFDPLGHYLLTAIVNPSNQQ GDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLLH

NFLHMLSSRSSGIQ TEPFHPPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEWTRTVLTLNSRS

EVESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPSSGLATESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQA

QEMLNNNIESERPGPSHLPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWHVSTTFEGMPPSGNQLPPLERTEGQMPSSS

RLELSSSASSQEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRR RRLLESSLISLSRYDGAGSREHPIYPDPAR RLSPAAY

YAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDFE - UNI9387 - EDNGDRSRHRAPRNARMSAPSLGRFVPR - UN

I6416 - RRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLAG - UNI5541 - GAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNA - UNI

6182 - ASVNVLVQNCKIYNDASCDISADGQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFG GPNAISVSLSPMGRYVMVGLASRRILLH

PSTEHMVAQVFRLQQAHGGETSMR - UNI3504 - RVFNVLYPMPADQRRHVSINSARWLPEPGLGLAYGTNKGDLVICRPE EALNSGIEYYWDQLS

ETVFTVHSSSRSSERPG - UNI27400 - GTSRATWRTDRDMGLMNAIGLQPRNPTTSVTSQGTQTLALQLQNAETQTEREEEEPGAASSGPGEG GE

GSEYGGSGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTESGAARTSSPQPSTSRGLPSEPGQLAERALSPRTASWDQP

STSGRELPQPALSSSSPVPIPVPLASNEGPTMHCNVTNNSHLPEGDGSNRGEAAGPSGEPQNR
Transcript ENSMUST00000045699
Sequence
AGATTTCCATGAGGACAGCTGACAAGGACCTGAATGGCCTCATTTTAGCTATTTCTGTGTGTGGAGCTATTGCTTGCTCCTTCAGTTCTGATCCCTGGTG

CGACAGTGGCTCCTGAGCACCATGAAAGTTGTCCCAGAGAAGAATGCTGTACGAATCCTCTGGGGCCGAGAACGGGGCACTCGTGCCATGGGTGCCCAGC

GGCTTCTGCAGGAGCTGGTGGAGGATAAGACTCGATGGATGAAATGGGAGGGCAAG - UNI24554 - AGAGTAGAACTGCCTGATAGTCCACGCTCG

ACCTTCTTACTGGCCTTCAGCCCAGACAG GACTCTCTTGGCATCCACACATGTGAACCATAACATCTATATTACAGAGGTTAAGACTGGCAAGTGTGTT

CACTCTCTGATCGGACACCGCCGTACTCCATGGTGTGTCACTTTTCACCCCACCATCTCAGGCCTTATTGCTTCTGGTTGCCTAGATGGGGAAGTTAGGA

TTTGGGATTTACAT GGGGGCAGTGAAAGCTGGTTCACAGACAGCAACAATGCCATAGCCTCCTTGGCTTTCCACCCTACGGCTCAGCTTCTACTAATTG

CCACTGCAAATGAGATCCATTTCTGGGATTGGAGTCGTCGGGAGCCCTTTGCTGTGGTGAAAACAGCCAGTGAGATGGAGCGTGTCCG - UNI32912 

- CCTGGTGAGATTTGATCCACTTGGACACTACTTACTTACAGCTATTGTTAACCCTTCTAATCAGCAG GGTGATGACGAACCAGAAATCCCTATAGAT

GGAACAGAGTTATCTCATTACCGTCAACGTGCCCTCCTGCAATCACAGCCAGTTCGCCGGACACCTCTCCTCCACAATTTCCTGCACATGCTGTCCTCCC

GTTCCTCTGGCATCCAG ACCGAGCCCTTCCATCCCCCGGAGCAGGCTTCATCAACGCAGCAGGACCAGGGCCTCCTGAACCGGCCGTCTGCCTTCAGTA

CAGTCCAGAGCAGCACTGCGGGCAACACGCTCCGCAACCTCAGTCTGGGTCCTACCCGGCGCTCTTTGGGGGGCCCTTTGTCTAGCCACCCTTCTAGGTA

TCACAGAGAACTAGCCCCTGGGCTGACAGGTTCTGAGTGGACCCGGACAGTACTCACTCTGAACTCTCGTTCTGAGGTAGAATCTATGCCCCCACCGAGG

ACCAGTGCCTCCTCAGTGAGTTTGCTTTCTGTACTGAGACAGCAGGAAGGTGGCTCTCAGGCATCTGTGTATACTTCAGCCACAGAAGGGAGGGGTTTTC

CATCATCAGGGTTGGCAACTGAGTCAGATGGAGGGAATGGTTCCAGCCAAAACAACTCAGGCAGCATTCGCCATGAGCTTCAATGTGACCTGAGACGCTT

CTTTTTGGAGTATGACAGGCTGCAGGAGCTGGATCAGAGCCTGAGTGGGGAAACTCCCCAGACCCAACAGGCCCAGGAAATGCTCAACAATAATATTGAA

TCTGAGAGACCAGGTCCTTCCCACCTGCCTACCCCACACAGCAGTGAGAACAACTCCAACCTGTCTCGGGGCCACCTTAATCGATGCCGTGCTTGCCATA

ATCTTCTAACCTTCAACAATGATACCCTTCGTTGGGAAAGAACCACACCTAACTACTCATCTGGTGAGGCTAGCTCTTCCTGGCACGTCTCCACTACCTT

TGAGGGCATGCCACCAAGTGGCAACCAGCTACCACCTCTTGAGCGGACTGAGGGCCAAATGCCTAGCTCCAGCAGGCTGGAGTTGAGCAGCTCTGCTAGT

TCACAAGAGGAGAGGACTGTGGGGGTGGCCTTTAACCAGGAGACAGGCCACTGGGAACGCATTTATACCCAGTCCAGCAGATCTGGAACTGTATCACAGG

AGGCCTTACATCAAGATATGCCTGAAGAAAGCTCTGAGGAAGACTCCCTCAGGAG ATTATCTCCTGCTGCATACTACGCCCAGAGGATGATCCAGTATC

TCTCAAGGAGAGACAGTATTCGCCAGCGCTCCATGCGCTACCAACAGAATCGGCTTCGTTCTTCCACCTCCTCTTCTTCCTCAGACAACCAGGGTCCATC

AGTAGAGGGAACCGACTTGGAATTTGAGGACTTTGA - UNI9387 - GGACAATGGTGACAGATCTAGGCACCGAGCTCCCCGAAATGCCCGAATGTC

TGCACCTTCACTTGGACGATTTGTTCCAAG - UNI6416 - GCGTTTTTTGCTGCCTGAGTACTTGCCTTATGCTGGGATTTTTCATGAACGTGGACA

GCCTGGCTTGGCTACTCATTCTTCTGTTAACAGGGTCCTGGCAG - UNI5541 - GGGCAGTAATTGGAGATGGACAGTCTGCTGTGGCCAGTAACAT

TGCCAATACTACCTACAGGCTCCAGTGGTGGGACTTCACTAAGTTTGACCTTCCAGAAATCAGTAATG - UNI6182 - CCTCTGTGAATGTCCTGGT

ACAGAATTGCAAGATCTACAATGATGCCAGCTGTGACATTTCTGCAGATGGTCAGCTCCTGGCAGCCTTCATCCCGAGCAGCCAGAGGGGCTTTCCTGAT

GAAGGCATCCTGGCAGTGTATTCCCTGGCCCCCCATAACTTGGGGGAAATGCTCTACACCAAGCGATTTG GTCCCAATGCCATTTCTGTAAGCCTGTCC

CCGATGGGCCGATACGTTATGGTGGGCTTGGCCTCACGAAGGATCCTACTGCACCCCTCCACAGAGCACATGGTAGCCCAGGTCTTCAGGCTGCAACAGG

CCCATGGTGGTGAGACTTCCATGAGG - UNI3504 - AGAGTTTTCAATGTCCTTTACCCCATGCCTGCAGACCAACGGAGACACGTCAGCATCAACT

CTGCCCGTTGGCTACCCGAGCCAGGGCTTGGTTTGGCCTATGGCACCAACAAAGGAGACTTGGTGATCTGCCGACCAGA GGCCTTAAACTCTGGCATCG

AGTACTACTGGGACCAGCTAAGTGAAACAGTCTTCACTGTCCACTCAAGTAGCAGGAGCAGCGAGCGGCCTGG - UNI27400 - AACCAGCAGAGCC

ACGTGGCGGACAGACAGAGACATGGGTTTGATGAATGCAATTGGGCTGCAGCCTCGGAACCCAACCACCTCTGTGACATCTCAGGGCACCCAGACTCTGG

CCCTCCAGTTGCAGAACGCTGAAACACAGACTGAGAGGGAGGAAGAGGAACCAGGGGCAGCATCTTCAGGTCCTGGTGAAG GCGAGGGCTCAGAATATG

GTGGCAGTGGGGAAGATGCCCTCAGCAGGATCCAGAGGCTGATGGCCGAGGGTGGCATGACAGCTGTGGTACAACGGGAACAGAGCACCACCATGGCCTC

CATGGGTGGCTTTGGCAACAACATCATCGTTAGCCACCGCATTCACCGCAGCTCCCAGACAGGCACAGAGTCAGGGGCTGCTCGTACCTCCTCACCCCAG

CCCTCCACCTCTCGAGGACTGCCATCAGAACCTGGGCAACTGGCAGAGCGAGCGCTAAGCCCCCGGACAGCCTCCTGGGACCAGCCTAGTACCTCTGGGA

GGGAACTACCCCAGCCAGCCCTGTCCTCTTCCTCCCCTGTCCCCATTCCAGTCCCCCTTGCCAGCAATGAGGGACCAACCATGCACTGCAATGTGACCAA

TAACAGTCACCTTCCTGAGGGTGATGGTAGCAACAGGGGGGAAGCTGCAGGCCCTAGTGGAGAGCCACAGAACCGATAGAGACAAAATGAGGCACTGGTA

CCTCCCTCAAGCTGCTGAGCAGAAGCAGGACCTCACAGCTGACTGGGAACTGTACACACAGAAGAGCTGATGCCTGCATCCAGGAACAGGAGGAATGAGA

GGGTGGGGCATGGAGCCAGTGGATAAGGGGGCAGTCCAAGGGGCAAGGCTGGCCTGGGGTACTAGAGCCTTCCATGATCTAGAGCCCAGAAGAACCACAC

TGCTGAGCCTGGTGTGAATGAAGAAGCAAGTGGGTGTCTCTGCTATGAACCCCCATTTCTCCTAGGATCACTGGCCTAGGGGACTCAAACAACCCTGGGC

AGAAGCCCCAGAAGAGTAAAGTCTTCCAGATTTAGACCACACCATCCTGGACAGAATGGTGGGACAGTTCTCCCCTGCCCACTACTGGAGGGACAAGCCA

CCAGGAGCAGAGGAGCAACACCCCCCCCCCATTGCTTCCATCTCTAAACCTTCCAGAGTTCCAGCCTCTCTCATCCTCTTAGCCCACAGAGATGGAAAAG

TCAGGCACAGCTTCCATGTCAGTGACTTATGCTCACCAAATGCGGACACCTGTGGAGTGAAGGAAATAGCCTGCTTGCCTGACACAGAATGGAGTCAATA

CATGGTGGTGAACAGGTCCTCAGGAGTGGGGGTGTAGGCTGGCCCGCCCCCAGCATGTCCATCAAGCTCCCCCCTCCACAAGGCCCTCCATGCAGCACCT

ATGGGTGTCAGTATTACCTAAGCATAGGCCAAAGCCAGCCCAGGGCTGGAGGGAGGAGATTCCAGGTCAGAATGTGAGGTCTTGGTCTGTGATTTGAGGT

GTTGCATGTGGAATCCTGAACTGTACGTGTAGTTTTTAGTGGCGAAATCAAGGCTCTGATCATTTTGTTTTTAGTATGAAAATGTGATTTCCTTTCTGTT

TGTCACTCATCATAGAAACATTGTGGTGGGAGGAGAGGGGATAGTCTACTGCTAATGAGGGAGACACCAAAGATCTACATCATTAAAATGATGACACGCC

CCTCA
Translation
MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGK - UNI24554 - RVELPDSPRSTFLLAFSPDR RTLLASTHVNHNIYITEVKT

GKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLH GGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEMERV

R - UNI32912 - RLVRFDPLGHYLLTAIVNPSNQQ GDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLLHNFLHMLSSRSSGIQ TEPFHPPEQAS

STQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEWTRTVLTLNSRSEVESMPPPRTSASSVSLLSVLRQQEG

GSQASVYTSATEGRGFPSSGLATESDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQAQEMLNNNIESERPGPSHLPTPHSSEN

NSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWHVSTTFEGMPPSGNQLPPLERTEGQMPSSSRLELSSSASSQEERTVGVAFNQETGH

WERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRR RLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDFE - 

UNI9387 - EDNGDRSRHRAPRNARMSAPSLGRFVPR - UNI6416 - RRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLAG - UNI5541 - G

AVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNA - UNI6182 - ASVNVLVQNCKIYNDASCDISADGQLLAAFIPSSQRGFPDEGILAVYSLA

PHNLGEMLYTKRFG GPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQVFRLQQAHGGETSMR - UNI3504 - RVFNVLYPMPADQRRHVSIN

SARWLPEPGLGLAYGTNKGDLVICRPE EALNSGIEYYWDQLSETVFTVHSSSRSSERPG - UNI27400 - GTSRATWRTDRDMGLMNAIGLQPRNP

TTSVTSQGTQTLALQLQNAETQTEREEEEPGAASSGPGEG GEGSEYGGSGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQ

TGTESGAARTSSPQPSTSRGLPSEPGQLAERALSPRTASWDQPSTSGRELPQPALSSSSPVPIPVPLASNEGPTMHCNVTNNSHLPEGDGSNRGEAAGPS

GEPQNR

For any suggestions or comments, please send an email to unitrap@crg.es