Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040520 (Manea)
Chromosomal location
Chr 4: 26251657 - 26273799 (-)
Description
mannosidase, endo-alpha Gene [Source:MGI (curated);Acc:Manea-001]
RefSeq_dna
NM_172865 
RefSeq_peptide
NP_766453.2 
UniGene
Mm.245602 
MGI
MGI:2444484 
Uniprot/SWISSPROT
Q6NXH2 
Uniprot/SPTREMBL
A8Y5Q7 
Human Ortholog
ENSG00000172469 (MANEA)
Omim not available
UniTrap UNI23880
Vector Insertion
Chr 4: 26268146 - 26273743
Public Clones not available
Private Clones OST241683 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041374
Sequence
GGAATCCAGTCGCGCTCAGCCCAGCAGCCCGGTTCCGCGCCGGTCCCCGCCGCTAG - UNI23880 - AAAAACATTTACTAGTTTGGAGTTTAAAGT

ATGTCATCATGGCAAAATTTCGAAGAAGGACCTGCATCCTTTTGTCACTTTTTATTCTATTTATTTTTTCTCTGATGATGGGCTTAAAGATGCTGTGGCC

AAACGCAGCATCCTTTGGACCTCCTTTTGGACTTGACCTCCTTCCAGAACTTCATCCACTAAATGCGCATTCGGGAAACAAAGCTGACTTCCAAAGGAGT

GATAGAATCAACATGGAAACAAACACCAAGGCTTTAAAAGGCGCTGGCATGACTGTGCTGCCAGCCAAAGCCTCTGAGGTGAACCTGGAAGAACTACCTC

CTCTGAATTACTTTTTACATGCATTTTATTACAGTTGGTATGGAAATCCACAGTTTGATGGTAAATATATACACTGGAATCATCCGGTCCTGGAACACTG

GGACCCTCGGATAGCCAAGAACTATCCACAAGGACAACATAGTCCTCCAGACGACATTGGCTCCAGTTTTTATCCTGAGTTAGGAAGTTACAGCTCTCGA

GACCCTTCTGTCATAGAAACTCACATGAAACAAATGCGCTCAGCCTCAATTG GAGTTCTGGCCCTGTCTTGGTACCCACCTGATTCAAGGGATGACAAT

GGCGAAGCTACTGATCACTTGGTGCCAACCATTTTGGATAAAGCTCATAAATATAATCTGAAG GTCACTTTTCACATAGAGCCATATAGCAATCGAGAT

GATCAAAACATGCATCAAAATATCAAGTATATTATAGACAA ATATGGAAACCATCCAGCCTTTTATAGATACAAGACCAGGACTGGGCATTCTCTGCCC

ATGTTTTATGTCTATGATTCTTACATCACAAAGCCTACAATATGGGCCAATCTGTTAACACCCTCCGGATCTCAGAGTGTTCGCAGTTCTCCTTATGATG

GATTGTTTATTGCACTTCTAGTAGAAGAAAAGCATAAAAATGATATTCTTCAGAGTGGTTTTGATGGTATTTACACATATTTTGCCACAAATGGCTTTAC

ATATGGCTCATCTCATCAGAATTGGAATAACCTGAAATCCTTTTGTGAAAAGAACAACTTGATGTTTATCCCAAGTGTAGGCCCAGGATACATAGATACA

AGCATCCGACCATGGAACACTCAGAACACCCGGAACAGAGTCAATGGGAAGTATTATGAAGTTGGTCTAAGTGCTGCACTCCAGACCCACCCCAGTTTAA

TTTCCATCACCTCTTTCAATGAGTGGCATGAAGGAACTCAAATTGAAAAGGCTGTCCCCAAAAGAACTGCTAACACGATATACCTGGATTACCGGCCTCA

TAAGCCAAGTCTTTATCTAGAACTAACTCGAAAGTGGTCTGAAAAATTCAGTAAGGAAAGAATGACGTATGCATTGGATCAACAGCAGCCTGCTTCATAA

TGTATCCCTTACAGTTTATCACGTCTACTAGCTTAAGTCAACATGCTGTGTTTTTGTTATGGAAAGAAAACTCAAAATCAATCTGTGTTTGCAATTATAA

CCTTTATCAGTTATTTCATTTTTACTTTTTAAAAGATTCGTTTTCCTACAATGGATAATACCATACAGAGAAAACATCTGACAAGAAAGATTGTGTCTGT

AACATTCCTGATGATGTGGTATTCTGAATTTCTAGCTACATTGAAATCTTAATGGGATAGCCTTTTAGTTTTTTGTTTCACAGTAGAAAAAAAAATGATT

ATATTATCATCACAAAAAGTAGCTAACGTCCAAGTAAGTCATACTTATATACTGGGTCCAAAGACATAGAAGTATGTACATGCTAAGTACATCTGGCAAC

AAAAGTTCAGGCTAACGAACAGTAACCAGATGTGCTTCATTTCTGGTCTCTTCAGTGAAGTTTGTTAATAATATTCAGATTCCGGCTGGCTTCCCCTGGT

GATCAAACTCACTTCTCAAGTTTCTTGTGAACACAAACTTGTTTAAGTAACAAGCTATTTTATTACATTTCTCTATTTCTGTTAGCCATGGTCTGTTCTC

GAATGGCTTTGTGCAGAGCATCCATCAGTGTCATCATTTGAAGACTTGGGTGCCTGTGGCTCTAAGTGCTTTTCTATGTTTAATGCCCTGCCTGGTGTGT

CCTGCTGAATTAAAGACTAGAAACAATATATAGTTTATTAAGTGTTAATGACTGGTACACGCCTTTAATCCCAGCACTTGGGAGGCAGAGGCAGGTGGGT

TTCTGAGTACGAGGCCAACTTAGTCTACAAAGTGAGTTCCAGGACAGCCAGAGCTATACAGAGAAACTCTGTCTCGAAAACCCAGAAAAATACATACATA

TATACATACATACATACATACATACATACATACATACATACATGTTAATGACTGCTCTTATCTATGAGGAAAACCATTGTTTCTCAGTGGTTAAAATAAA

TGTTCACCAGAAACTACTGAACTGACTGAAAAAGGATAACATTAATCCTCAAGAGTGTTTTCCTTTTAATATTTTCATTTAATTTTACTGTAAGACAGAA

AAAAATTGCTTATCACTTCAAAACTAGAGATAAATAGTTTTAAAGTAACATATTTTTCAGTTATGTCCTCATATTTGGATGTCTTACACTTTTGGTTTAA

AAAGAAACTGTTAGTGATATAGTTACAAATTGAAAAGTTCTATGCTAAAAATAAATTTTTGTAAAAGTGAAAATAGGAGAAATTGACTGAATTCAATATT

TATAATTAAAATAGAAAAACCACCTAGTCTATATAATTTTACACAACTGTTATTTCTTAGTACTACAGAGAGGACCAGTTGAGTAACACTAACAAATATT

GCATGCCAGCCTTCATAGCATAAAGACATTTAGAAACCAGTAAGTTCTGGGATGTATTTTAAAATACACAGCAGAGAGGAAGCAGTTTTAGGGTAAGAGT

GACTGCTCTGTGGGGAAAGTTCTTGCTGTGCAAGCCTGAAGACCTGAGTCTGAACACCTAGAACTCAAACAGATACGAGCTCACGAGCATGCATGTTCTA

GTCCACGGCTTCTCCAGTGAGCGAGAGAAAGTGGACACAGTACAGAGCCCAGAAGTGCATGAGCCAGTTAGCCTGCCGTACACAACAGCACTAAGACATA

TGTCTCAAACATGGTGGGCAGCAGAGGTCGGCAGGCAAGGTTGCTCTGACATTCAGACCCATGTCATGTCATAGTCAGTCTCCCTCTTACTCTGGAATGT

TTGAACATACTTACACACAGAGCTTTTTTAAAACGCATGTTTAAAATAATTCTTTTAGCATAAAATCTTTTTCAAGAGATATACTAACCTTATTAAATTA

AAATTTTCTATTTATCAGAATATTATTGGGCCATTAAAAATTATGAAAATAATAGTCTGATTTTTCCAGATAAATTGTAAGAATAATTTAATATAGTAGT

ATTTTAATATTACACATCTCCATTGGGATAAGGAGAAATATAACCTATAGATCTTTTTTTTTTGCTTTGCTACTAGATTAAAGCTGAATTTTAATACATA

GACTTTTACAGCATATGCTGTTTTCTTCATACCTTATGTTACATTTTCTATTTGAGTCCACCATGACAAAAAGTGAATGTTATGAAACAATTCTGAGACA

GAATAAGTCTACGCAAATAAGGTCTAGCAACTGTCCATAAGAGTTCAACTTTCTCAGTGGACAGCTCACTCTAGCTCTTGCTGTTCCCAGTACATCTACC

CGATCAATAGTCAGTCAGAACTTAAAATTAGACAGACGTTATCTTTATTTTTTTAAAGAATTGCTGTCTAAGGAATGACTGAAATATCTTTTCATAAGAC

TTATTAGTTGATAATTATATAAAGGACCATAGCCACCCCTCTGGTTTCCACAACCAAATATTCAGCCAACTAAGGCTCAAAATACTTGGGAACAAAACTC

CACTTGTATATATCAAGCATGTTTAGTGTGTCTCCATCCCTTAAGCCATACAGTATAACCACCACTTAGATTTTTCTAGGTATTACAAATAAGTTGAGAG

GGTTTAAAGTGTACCTGAAGATCATTGTGGAATTATATTCAAATCCTGTTCCACGTTTTAAAACGACCTAAGCATATTCAGCCATTTTTACCTTTGGGTC

CTGAAGCCAGTTCTACACAGATATCAAGGGATGGCTATATTCACAATATTGCTAGTGATTGTTAGAGGAGCCTCTTTTTCCAGGTGTCTCTGCTGTCTGA

CTGGAAACACAGCTGGAATTGCAATGATCACAAGTCAATCTAATCAAATGATCCTGTTCTTATTTTTATAAATCTGAATATTAGGATTCAGTAAACTTAA

AGAGGTACAGTATGAATTAAATCAGTTTTTTAATAAGCCTTTTGTTTTGTGGATTAACCCATCTAATTGTTTAGAGAACTAGATCCTTATTTCTTCTTTC

AAGATGTAATTGTAAAAGACTGCCCTTATTAGTGTTTGAATTGTATATTAACTTGCTTATTTATGTGTGTAAAGTGGAAAATGTTTTATTTTATTATATG

GTGTTAATTTTGTCTAATAAAAGCATAAATGAATACTGTTC
Translation
 - UNI23880 - MAKFRRRTCILLSLFILFIFSLMMGLKMLWPNAASFGPPFGLDLLPELHPLNAHSGNKADFQRSDRINMETNTKALKGAGMTVLPA

KASEVNLEELPPLNYFLHAFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYPQGQHSPPDDIGSSFYPELGSYSSRDPSVIETHMKQMRSASIG GVL

ALSWYPPDSRDDNGEATDHLVPTILDKAHKYNLK VTFHIEPYSNRDDQNMHQNIKYIIDK KYGNHPAFYRYKTRTGHSLPMFYVYDSYITKPTIWANL

LTPSGSQSVRSSPYDGLFIALLVEEKHKNDILQSGFDGIYTYFATNGFTYGSSHQNWNNLKSFCEKNNLMFIPSVGPGYIDTSIRPWNTQNTRNRVNGKY

YEVGLSAALQTHPSLISITSFNEWHEGTQIEKAVPKRTANTIYLDYRPHKPSLYLELTRKWSEKFSKERMTYALDQQQPAS

For any suggestions or comments, please send an email to unitrap@crg.es