Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040524 (Zfp609)
Chromosomal location
Chr 9: 65543269 - 65643175 (-)
Description
zinc finger protein 609 Gene [Source:MGI Symbol;Acc:MGI:2674092]
RefSeq_dna
NM_172536 
RefSeq_peptide
NP_766124.2 
MGI
MGI:2674092 
Uniprot/SWISSPROT
Q8BZ47 
Uniprot/SPTREMBL
B2RWS7 
Human Ortholog
ENSG00000180357 (ZNF609)
Omim not available
UniTrap UNI1451
Vector Insertion
Chr 9: 65579009 - 65642428
Public Clones (sanger) CD0574 (sanger) RRJ186 (baygenomics) XK115 (baygenomics) IST14981H8 (tigm)
IST14683G12 (tigm)
Private Clones OST90445 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5825
Vector Insertion
Chr 9: 65553986 - 65578782
Public Clones CSH682 (baygenomics) IST14407C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32002
Vector Insertion
Chr 9: 65550078 - 65553986
Public Clones IST14700G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8832
Vector Insertion
Chr 9: 65548996 - 65550078
Public Clones XL515 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046309
Sequence
TGCAAACCCGGTTGAGACATACGACAGTGGGGATGAATGGGACATTGGAGTAGGGAACCTCATCATCGACCTGGACGCCGATCTGGAAAAGGACCAGCAG

AAACTGGAAATGTCAGGCTCCAAGGAGGTGGGGATACCAGCCCCCAATGCTGTGGCCACACTACCAGACAACATCAAGTTTGTCACCCCAGTGCCAGGTC

CTCAAGGGAAGGAAGGCAAATCAAAATCCAAAAGGAGTAAGAGTGGCAAAGACGCTAGCAAGCCCACTCCAGGGACTTCCTTGTTCTCTCCAAGTGAGGG

AGCAGCCAGCAAGAAAGAGGTGCAGGGTCGCGCAGGAGATGGTGCCAGTGCGGGAGGCCTGGTTGCTGCTGTTGCTCCCAAGGGCTCAGAGAAGGCTGCT

AAGGCGTCACGCAGTGTAGCTGGCTCCAAAAAGGAAAAGGAGAACAGCTCATCTAAGGGCAAGAAGGAGAGAAGTGAAGGCGTGGGGACTTGTTCGGAAA

AGGATCCTGGGGTCCTCCAGCCAGTTCCCTTGGGAGGACGGGGTAGTCAGTATGATGGAAGTGCAGGGATGGACACAGGAACCGTGGAGCCGCTTGGGAG

TATAGCTATTGAACCTGGGGCAGCGCTCAATCCTTTGGGAACTAAGCCGGAGCCAGAGGAAGGGGAGAATGAGTGCCGGCCACTAAAGAAAGTCAAGTCT

GAAAAG - UNI1451 - ATGGAGTCCCCAGTCTCCACCCCAGCGGTGCTGCCACTGCACCTGTTAGTGCCAGTGGTCAATAATGACATCTCATCTCCC

TGTGAGCAGATCATGGTCCGTACCCGATCAGTTGGTGTCAACACATGCGACGTGGCTCTAGCCACAGAGCCTGAGTGCTTAGGCCCCTGTGAGCCTGGAA

CCAGCGTCAACCTTGAAGGCATCGTGTGGCAGGAAACAGAAGATG - UNI5825 - - UNI32002 - GGATGTTGGTGGTAAATGTGACATGGAGA

AACAAGACATATGTAGGTACACTTCTTGACTGCACAAGGCATGATTGGGCACCCCCAAG - UNI32002 - GTTCTGTGACTCCCCCACCAGTGACTT

GGAAATGCGGAACGGCCGAGGAAGAGGCAAGCGCATGCGTCCCAGCAGTAACACACCTGTCAGTGAGGCAGCCGCAGCCTCTGACAGCAAAGGGACCAGC

AGCAGCAGCAAGACCCGAGCAGGAGCCAATAGCAAAGGCCGTCGGGGTAGCCAGAACTCCTCAGAGCACCGCCCTCCTGCTAGCAGCACCTCTGAGGATG

TCAAAGCCAGCCCTTCCTCAGCCAATAAGCGGAAAAGCAAACCTCTTTCAGACATGGAGCTGAATTCTAGCTCAGAGGACTCCAAAGGGAGCAAGCGTGT

CCGTACAAATTCCATGGGCTCAGCCACCGGGCCCCTCCCTGGGACCAAGGTAGAACCCACTCTTGTGGACAGAAATTGTCCCTCCCCGGTCCTGATTGAC

TGTCCCCACCCAAACTGCAACAAAAAGTACAAGCACATCAATGGGCTTAAGTACCACCAAGCTCACGCCCACACGGATGACGACAGCAAACCGGAAGCTG

ATGGAGACAGTGAGTATGGAGAAGAGCCCGCCCTCCATGCAGACCTCAGCTGCAACGGTGCACCTGTCCCACAGAAAGGATCCTTGTCCCCTGCCCGCTC

AGCTACCCCCAAAGTTCGGCTTGTTGAGCCTCACAGCCCTTCCCCTTCGAGCAAATTCAGCACAAAAGGCCTCTGTAAGAAAAAACTGAGTGGGGAGGGA

GACACAGACCCTGGAGCCTTATCCAATGATGGCTCTGATGACGGGCCCTCGGTAATGGATGAAACAAGCAATGATGCCTTTGACTCTTTGGAAAGGAAGT

GTATGGAAAAGGAAAAGTGTAAAAAGCCCTCCAGTCTGAAATCTGAAAAGATTCCATCCAAGAGCTTAAAATCAGCCCGCCCCATTGCCCCTGCCATCCC

CCCACAACAGATCTACACTTTCCAGACAGCCACCTTCACAGCAGCAAGCCCAGGTTCCTCCTCAGGCTTGACCACCACCGTGGTCCAAGCAATGCCCAAC

AGTCCCCAACTCAAGCCCATTCAGCCCAAGCCCACTGTTATGGGAGAGCCTTTCACAGTCAACCCTGCCCTGACCCCTGCCAAGGACAAGAAAAAGAAAG

ACAAAAAAAAGAAGGACTCATCAAAGGAACTTGAAAGTCCTCTGACCCCTGGGAAGGTATGCCGAGCAGAAGAAGGTAAGAGCCCGTTCAGAGACGCAGC

AGGAGATGGAATCAAAGTGGAGAGCCTTCTGAACGGCTCCTCAGAGTCCCACCAAAGCCGGTTAGCTAGTATCAAGGCTGAGGCTGATAAGATTTACAGT

TTCACTGACAATGCCCCCAGCCCTTCAATTGGAGGCAGCAGCCGCCTAGATAGTACTACCCCGACCCAACCCCTAACTCCCCTCCACGTAGTGACCCAGA

ATGGAGCCGAAGCCAGCTCAGTCAAAACCAATAGCCCTGCCTACTCTGACATCTCTGATGCTGGGGAGGATGGGGAGGGCAAGGTGGACAGTGCCAAGTC

GAAGGACCCCGAGCAGCTGGTTAAAGAAGGGGCTAAGAAAACACTGTTCCCCCCTCAGCCACAGAGCAAAGACTCCCCATATTATCAAGGCTTTGAAAGT

TACTACTCTCCAGGTTATGCACAGTCCAGCCCAGGGACTCTCACCTCAAGCAGCCAGGCAGGAATGGAGGGCCAGCCCCTAAAGACAAAAAAGGATGAGG

AGCCTGAGAGCGTAGAAGGGAAAGTAAAGAATGATGTCTGTGAGGAAAAGAAGCCGGAGCTGAGCAATTCCAGTCAGCAGCCCTCCGTCATCCAGCAGCG

GCCCAACATGTACATGCAGTCCCTGTACTACAACCAGTATGCCTACGTGCCTCCTTATGGCTACAGTGACCAGAGTTACCACAGCCACCTCCTGAGTACC

AACACCGCTTATCGGCAGCAGTATGAAGAACAGCAGAAGCGGCAGAGCCTGGAGCAGCAGCAGCAGCAGCAGCGGGGACTGGACAAGAAGACAGAGATGG

GCCTGAAAGAGCGGGAGGCATCGCTCAAGGAAGAGTGGAAGCAAAAGCCCTCAATTCCACCAACTCTCACCAAGGCTCCCAGCCTGACAGACCTGGTGAA

GTCAGGGCCCGGCAAGGCCAAGGAGCCTGGGACAGATCCTGCCAAGTCTGTCATCATTCCCAAGTTAGATGACTCATCAAAACTCCCCAGCCAGCCCCCT

GAAGGCCTTAAAGGGAAGCTGGGTGAGGCCAGCCACCTAGGCAAGGAGGCGTCTGAGGCTAAGACGGGCACTGAGTGTGGCCGACAGGCAGAGGTGGATC

CAATACTCTGGTACCGACAG - UNI8832 - - UNI32002 - GAGACGGAGTCTCGAATGTGGACATATGTTTATCCTGCCAAATACTCAGACATC

AAGTCAGAGGATGATCGGTGGAAAGAGGAACGGGACCGAAAATTAAAGGAGGACAGGAGCCGGAGTAAGGACTCTGTTCCCAAGGAAGACGGGAAGGAAA

GCACAAGTAGTGACTGCAAGCTACCCCCATCTGAGGAATCCCGCCTCGGGAGCAAGGAGCCCCGACCAAGTGTCCATGTGCCTGTGTCCTCCCCGCTCAC

CCAGCACCAGTCCTACATCCCCTACATGCATGGCTACTCTTACAGCCAGTCATATGACCCCAACCACCCCAGCTACCGGGGGATGCCTGCTGTGATGATG

CAGAACTACCCAG GTTCCTATTTGCCTTCCAGCTATTCTTTCTCCCCGTATGGCAGCAAGGTCTCAGGTGGCGAGGACGCTGACAAGGCCCGTGCCAGC

CCCAGTGTGAGCTGTAAAGCCAGCTCAGAGTCCAAAGCCCTGGACATCTTGCAGCAACATGCCAGTCACTACAAGAGCAAGTCTCCCACG ATAAGTGAT

AAAAATTCTCAGGAGAGAGATCGAGGAGGCTGTGGGGTGGTTGGGGGTGGTGGCAGCTGTGGCAGTGTTGCGGGAGCAGGAGGTACTGACAGGAGTGCCG

ACCGGCCCCGCACATCCCCTTCCCAGCGCCTGATGTCCACACACCACCACCACCACCACTTGGGCTATTCCTTGCTCCCAGCACAGTACAACCTACCCTA

TGCCGCAG GGCTTTCTTCTACAGCCATTGTTGCCAGCCAGCAAGGCTCAACTCCCTCACTCTACCCACCCCCCCGGAGGTGAGAATG AACACCAAGTG

CCCAGATGAAGTCAGCTTCATGGGCCAGACTGGCTCATTCGAGGTGATGCTGGAGGTGCCATCTTACCATCAGTTACGGTGTTGATCATCCTGTTTGCCA

TTCCGACCGTGACTGAAGGCAGACCCTTGGCTGCCTCACCTCCACTAGACCCTCCGACCCCCGACCCTCCCTCTTCCTCAGGAGCTGGAGAACTGGTACT

TTGCAAAAATATTTATTCTCTC
Translation
MSGSKEVGIPAPNAVATLPDNIKFVTPVPGPQGKEGKSKSKRSKSGKDASKPTPGTSLFSPSEGAASKKEVQGRAGDGASAGGLVAAVAPKGSEKAAKAS

RSVAGSKKEKENSSSKGKKERSEGVGTCSEKDPGVLQPVPLGGRGSQYDGSAGMDTGTVEPLGSIAIEPGAALNPLGTKPEPEEGENECRPLKKVKSEK 

- UNI1451 - MESPVSTPAVLPLHLLVPVVNNDISSPCEQIMVRTRSVGVNTCDVALATEPECLGPCEPGTSVNLEGIVWQETEDG - UNI5825 -

 - UNI32002 - GMLVVNVTWRNKTYVGTLLDCTRHDWAPPR - UNI32002 - RFCDSPTSDLEMRNGRGRGKRMRPSSNTPVSEAAAASDSKGT

SSSSKTRAGANSKGRRGSQNSSEHRPPASSTSEDVKASPSSANKRKSKPLSDMELNSSSEDSKGSKRVRTNSMGSATGPLPGTKVEPTLVDRNCPSPVLI

DCPHPNCNKKYKHINGLKYHQAHAHTDDDSKPEADGDSEYGEEPALHADLSCNGAPVPQKGSLSPARSATPKVRLVEPHSPSPSSKFSTKGLCKKKLSGE

GDTDPGALSNDGSDDGPSVMDETSNDAFDSLERKCMEKEKCKKPSSLKSEKIPSKSLKSARPIAPAIPPQQIYTFQTATFTAASPGSSSGLTTTVVQAMP

NSPQLKPIQPKPTVMGEPFTVNPALTPAKDKKKKDKKKKDSSKELESPLTPGKVCRAEEGKSPFRDAAGDGIKVESLLNGSSESHQSRLASIKAEADKIY

SFTDNAPSPSIGGSSRLDSTTPTQPLTPLHVVTQNGAEASSVKTNSPAYSDISDAGEDGEGKVDSAKSKDPEQLVKEGAKKTLFPPQPQSKDSPYYQGFE

SYYSPGYAQSSPGTLTSSSQAGMEGQPLKTKKDEEPESVEGKVKNDVCEEKKPELSNSSQQPSVIQQRPNMYMQSLYYNQYAYVPPYGYSDQSYHSHLLS

TNTAYRQQYEEQQKRQSLEQQQQQQRGLDKKTEMGLKEREASLKEEWKQKPSIPPTLTKAPSLTDLVKSGPGKAKEPGTDPAKSVIIPKLDDSSKLPSQP

PEGLKGKLGEASHLGKEASEAKTGTECGRQAEVDPILWYRQ - UNI8832 - - UNI32002 - ETESRMWTYVYPAKYSDIKSEDDRWKEERDRKL

KEDRSRSKDSVPKEDGKESTSSDCKLPPSEESRLGSKEPRPSVHVPVSSPLTQHQSYIPYMHGYSYSQSYDPNHPSYRGMPAVMMQNYPG GSYLPSSYS

FSPYGSKVSGGEDADKARASPSVSCKASSESKALDILQQHASHYKSKSPT ISDKNSQERDRGGCGVVGGGGSCGSVAGAGGTDRSADRPRTSPSQRLMS

THHHHHHLGYSLLPAQYNLPYAAG GLSSTAIVASQQGSTPSLYPPPRR 
Transcript ENSMUST00000113785
Sequence
ATGTCCTTGAGCAGTGGAGCCTGCGGAGGGAAAGGAGTGGATGCAAACCCGGTTGAGACATACGACAGTGGGGATGAATGGGACATTGGAGTAGGGAACC

TCATCATCGACCTGGACGCCGATCTGGAAAAGGACCAGCAGAAACTGGAAATGTCAGGCTCCAAGGAGGTGGGGATACCAGCCCCCAATGCTGTGGCCAC

ACTACCAGACAACATCAAGTTTGTCACCCCAGTGCCAGGTCCTCAAGGGAAGGAAGGCAAATCAAAATCCAAAAGGAGTAAGAGTGGCAAAGACGCTAGC

AAGCCCACTCCAGGGACTTCCTTGTTCTCTCCAAGTGAGGGAGCAGCCAGCAAGAAAGAGGTGCAGGGTCGCGCAGGAGATGGTGCCAGTGCGGGAGGCC

TGGTTGCTGCTGTTGCTCCCAAGGGCTCAGAGAAGGCTGCTAAGGCGTCACGCAGTGTAGCTGGCTCCAAAAAGGAAAAGGAGAACAGCTCATCTAAGGG

CAAGAAGGAGAGAAGTGAAGGCGTGGGGACTTGTTCGGAAAAGGATCCTGGGGTCCTCCAGCCAGTTCCCTTGGGAGGACGGGGTAGTCAGTATGATGGA

AGTGCAGGGATGGACACAGGAACCGTGGAGCCGCTTGGGAGTATAGCTATTGAACCTGGGGCAGCGCTCAATCCTTTGGGAACTAAGCCGGAGCCAGAGG

AAGGGGAGAATGAGTGCCGGCCACTAAAGAAAGTCAAGTCTGAAAAG - UNI1451 - ATGGAGTCCCCAGTCTCCACCCCAGCGGTGCTGCCACTGC

ACCTGTTAGTGCCAGTGGTCAATAATGACATCTCATCTCCCTGTGAGCAGATCATGGTCCGTACCCGATCAGTTGGTGTCAACACATGCGACGTGGCTCT

AGCCACAGAGCCTGAGTGCTTAGGCCCCTGTGAGCCTGGAACCAGCGTCAACCTTGAAGGCATCGTGTGGCAGGAAACAGAAGATG - UNI5825 - -

 UNI32002 - GGATGTTGGTGGTAAATGTGACATGGAGAAACAAGACATATGTAGGTACACTTCTTGACTGCACAAGGCATGATTGGGCACCCCCAAG

 - UNI32002 - GTTCTGTGACTCCCCCACCAGTGACTTGGAAATGCGGAACGGCCGAGGAAGAGGCAAGCGCATGCGTCCCAGCAGTAACACACCTG

TCAGTGAGGCAGCCGCAGCCTCTGACAGCAAAGGGACCAGCAGCAGCAGCAAGACCCGAGCAGGAGCCAATAGCAAAGGCCGTCGGGGTAGCCAGAACTC

CTCAGAGCACCGCCCTCCTGCTAGCAGCACCTCTGAGGATGTCAAAGCCAGCCCTTCCTCAGCCAATAAGCGGAAAAGCAAACCTCTTTCAGACATGGAG

CTGAATTCTAGCTCAGAGGACTCCAAAGGGAGCAAGCGTGTCCGTACAAATTCCATGGGCTCAGCCACCGGGCCCCTCCCTGGGACCAAGGTAGAACCCA

CTCTTGTGGACAGAAATTGTCCCTCCCCGGTCCTGATTGACTGTCCCCACCCAAACTGCAACAAAAAGTACAAGCACATCAATGGGCTTAAGTACCACCA

AGCTCACGCCCACACGGATGACGACAGCAAACCGGAAGCTGATGGAGACAGTGAGTATGGAGAAGAGCCCGCCCTCCATGCAGACCTCAGCTGCAACGGT

GCACCTGTCCCACAGAAAGGATCCTTGTCCCCTGCCCGCTCAGCTACCCCCAAAGTTCGGCTTGTTGAGCCTCACAGCCCTTCCCCTTCGAGCAAATTCA

GCACAAAAGGCCTCTGTAAGAAAAAACTGAGTGGGGAGGGAGACACAGACCCTGGAGCCTTATCCAATGATGGCTCTGATGACGGGCCCTCGGTAATGGA

TGAAACAAGCAATGATGCCTTTGACTCTTTGGAAAGGAAGTGTATGGAAAAGGAAAAGTGTAAAAAGCCCTCCAGTCTGAAATCTGAAAAGATTCCATCC

AAGAGCTTAAAATCAGCCCGCCCCATTGCCCCTGCCATCCCCCCACAACAGATCTACACTTTCCAGACAGCCACCTTCACAGCAGCAAGCCCAGGTTCCT

CCTCAGGCTTGACCACCACCGTGGTCCAAGCAATGCCCAACAGTCCCCAACTCAAGCCCATTCAGCCCAAGCCCACTGTTATGGGAGAGCCTTTCACAGT

CAACCCTGCCCTGACCCCTGCCAAGGACAAGAAAAAGAAAGACAAAAAAAAGAAGGACTCATCAAAGGAACTTGAAAGTCCTCTGACCCCTGGGAAGGTA

TGCCGAGCAGAAGAAGGTAAGAGCCCGTTCAGAGACGCAGCAGGAGATGGAATCAAAGTGGAGAGCCTTCTGAACGGCTCCTCAGAGTCCCACCAAAGCC

GGTTAGCTAGTATCAAGGCTGAGGCTGATAAGATTTACAGTTTCACTGACAATGCCCCCAGCCCTTCAATTGGAGGCAGCAGCCGCCTAGATAGTACTAC

CCCGACCCAACCCCTAACTCCCCTCCACGTAGTGACCCAGAATGGAGCCGAAGCCAGCTCAGTCAAAACCAATAGCCCTGCCTACTCTGACATCTCTGAT

GCTGGGGAGGATGGGGAGGGCAAGGTGGACAGTGCCAAGTCGAAGGACCCCGAGCAGCTGGTTAAAGAAGGGGCTAAGAAAACACTGTTCCCCCCTCAGC

CACAGAGCAAAGACTCCCCATATTATCAAGGCTTTGAAAGTTACTACTCTCCAGGTTATGCACAGTCCAGCCCAGGGACTCTCACCTCAAGCAGCCAGGC

AGGAATGGAGGGCCAGCCCCTAAAGACAAAAAAGGATGAGGAGCCTGAGAGCGTAGAAGGGAAAGTAAAGAATGATGTCTGTGAGGAAAAGAAGCCGGAG

CTGAGCAATTCCAGTCAGCAGCCCTCCGTCATCCAGCAGCGGCCCAACATGTACATGCAGTCCCTGTACTACAACCAGTATGCCTACGTGCCTCCTTATG

GCTACAGTGACCAGAGTTACCACAGCCACCTCCTGAGTACCAACACCGCTTATCGGCAGCAGTATGAAGAACAGCAGAAGCGGCAGAGCCTGGAGCAGCA

GCAGCAGCAGCAGCGGGGACTGGACAAGAAGACAGAGATGGGCCTGAAAGAGCGGGAGGCATCGCTCAAGGAAGAGTGGAAGCAAAAGCCCTCAATTCCA

CCAACTCTCACCAAGGCTCCCAGCCTGACAGACCTGGTGAAGTCAGGGCCCGGCAAGGCCAAGGAGCCTGGGACAGATCCTGCCAAGTCTGTCATCATTC

CCAAGTTAGATGACTCATCAAAACTCCCCAGCCAGCCCCCTGAAGGCCTTAAAGGGAAGCTGGGTGAGGCCAGCCACCTAGGCAAGGAGGCGTCTGAGGC

TAAGACGGGCACTGAGTGTGGCCGACAGGCAGAGGTGGATCCAATACTCTGGTACCGACAG - UNI8832 - - UNI32002 - GAGACGGAGTCTC

GAATGTGGACATATGTTTATCCTGCCAAATACTCAGACATCAAGTCAGAGGATGATCGGTGGAAAGAGGAACGGGACCGAAAATTAAAGGAGGACAGGAG

CCGGAGTAAGGACTCTGTTCCCAAGGAAGACGGGAAGGAAAGCACAAGTAGTGACTGCAAGCTACCCCCATCTGAGGAATCCCGCCTCGGGAGCAAGGAG

CCCCGACCAAGTGTCCATGTGCCTGTGTCCTCCCCGCTCACCCAGCACCAGTCCTACATCCCCTACATGCATGGCTACTCTTACAGCCAGTCATATGACC

CCAACCACCCCAGCTACCGGGGGATGCCTGCTGTGATGATGCAGAACTACCCAG GTTCCTATTTGCCTTCCAGCTATTCTTTCTCCCCGTATGGCAGCA

AGGTCTCAGGTGGCGAGGACGCTGACAAGGCCCGTGCCAGCCCCAGTGTGAGCTGTAAAGCCAGCTCAGAGTCCAAAGCCCTGGACATCTTGCAGCAACA

TGCCAGTCACTACAAGAGCAAGTCTCCCACG ATAAGTGATAAAAATTCTCAGGAGAGAGATCGAGGAGGCTGTGGGGTGGTTGGGGGTGGTGGCAGCTG

TGGCAGTGTTGCGGGAGCAGGAGGTACTGACAGGAGTGCCGACCGGCCCCGCACATCCCCTTCCCAGCGCCTGATGTCCACACACCACCACCACCACCAC

TTGGGCTATTCCTTGCTCCCAGCACAGTACAACCTACCCTATGCCGCAG GGCTTTCTTCTACAGCCATTGTTGCCAGCCAGCAAGGCTCAACTCCCTCA

CTCTACCCACCCCCCCGGAGGTGAGAATG AACACCAAGTGCCCAGATGAAGTCAGCTTCATGGGCCAGACTGGCTCATTCGAGGTGATGCTGGAGGTGC

CATCTTACCATCAGTTACGGTGTTGATCATCCTGTTTGCCATTCCGACCGTGACTGAAGGCAGACCCTTGGCTGCCTCACCTCCACTAGACCCTCCGACC

CCCGACCCTCCCTCTTCCTCAGGAGCTGGAGAACTGGTACTTTGCAAAAATATTTATTCTCTC
Translation
MSLSSGACGGKGVDANPVETYDSGDEWDIGVGNLIIDLDADLEKDQQKLEMSGSKEVGIPAPNAVATLPDNIKFVTPVPGPQGKEGKSKSKRSKSGKDAS

KPTPGTSLFSPSEGAASKKEVQGRAGDGASAGGLVAAVAPKGSEKAAKASRSVAGSKKEKENSSSKGKKERSEGVGTCSEKDPGVLQPVPLGGRGSQYDG

SAGMDTGTVEPLGSIAIEPGAALNPLGTKPEPEEGENECRPLKKVKSEK - UNI1451 - MESPVSTPAVLPLHLLVPVVNNDISSPCEQIMVRTRSV

GVNTCDVALATEPECLGPCEPGTSVNLEGIVWQETEDG - UNI5825 - - UNI32002 - GMLVVNVTWRNKTYVGTLLDCTRHDWAPPR - UNI

32002 - RFCDSPTSDLEMRNGRGRGKRMRPSSNTPVSEAAAASDSKGTSSSSKTRAGANSKGRRGSQNSSEHRPPASSTSEDVKASPSSANKRKSKPL

SDMELNSSSEDSKGSKRVRTNSMGSATGPLPGTKVEPTLVDRNCPSPVLIDCPHPNCNKKYKHINGLKYHQAHAHTDDDSKPEADGDSEYGEEPALHADL

SCNGAPVPQKGSLSPARSATPKVRLVEPHSPSPSSKFSTKGLCKKKLSGEGDTDPGALSNDGSDDGPSVMDETSNDAFDSLERKCMEKEKCKKPSSLKSE

KIPSKSLKSARPIAPAIPPQQIYTFQTATFTAASPGSSSGLTTTVVQAMPNSPQLKPIQPKPTVMGEPFTVNPALTPAKDKKKKDKKKKDSSKELESPLT

PGKVCRAEEGKSPFRDAAGDGIKVESLLNGSSESHQSRLASIKAEADKIYSFTDNAPSPSIGGSSRLDSTTPTQPLTPLHVVTQNGAEASSVKTNSPAYS

DISDAGEDGEGKVDSAKSKDPEQLVKEGAKKTLFPPQPQSKDSPYYQGFESYYSPGYAQSSPGTLTSSSQAGMEGQPLKTKKDEEPESVEGKVKNDVCEE

KKPELSNSSQQPSVIQQRPNMYMQSLYYNQYAYVPPYGYSDQSYHSHLLSTNTAYRQQYEEQQKRQSLEQQQQQQRGLDKKTEMGLKEREASLKEEWKQK

PSIPPTLTKAPSLTDLVKSGPGKAKEPGTDPAKSVIIPKLDDSSKLPSQPPEGLKGKLGEASHLGKEASEAKTGTECGRQAEVDPILWYRQ - UNI883

2 - - UNI32002 - ETESRMWTYVYPAKYSDIKSEDDRWKEERDRKLKEDRSRSKDSVPKEDGKESTSSDCKLPPSEESRLGSKEPRPSVHVPVSSP

LTQHQSYIPYMHGYSYSQSYDPNHPSYRGMPAVMMQNYPG GSYLPSSYSFSPYGSKVSGGEDADKARASPSVSCKASSESKALDILQQHASHYKSKSPT

 ISDKNSQERDRGGCGVVGGGGSCGSVAGAGGTDRSADRPRTSPSQRLMSTHHHHHHLGYSLLPAQYNLPYAAG GLSSTAIVASQQGSTPSLYPPPRR 


For any suggestions or comments, please send an email to unitrap@crg.es