Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040549 (Ckap5)
Chromosomal location
Chr 2: 91366994 - 91460820 (+)
Description
cytoskeleton associated protein 5 Gene [Source:MGI (curated);Acc:Ckap5-001]
RefSeq_dna
NM_029437 
RefSeq_peptide
NP_083713.1 
UniGene
Mm.168478 
MGI
MGI:1923036 
Uniprot/SPTREMBL
A0PJ77 A2AGT5 Q0VGR0 Q3TML9 Q3UDY6 Q4V782 Q6PB55 Q80U79 Q8K250 Q9CUN0 B2RRC4 Q4VAE7 A2AGT6 
Human Ortholog
ENSG00000175216 (CKAP5)
Omim not available
UniTrap UNI30144
Vector Insertion
Chr 2: 91367008 - 91386489
Public Clones (ggtc) D104C08 (ggtc) IST14984C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10915
Vector Insertion
Chr 2: 91367008 - 91386478
Public Clones P089E03 (ggtc) W266F01 (ggtc) D048D11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29035
Vector Insertion
Chr 2: 91386573 - 91388930
Public Clones not available
Private Clones OST11631 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26812
Vector Insertion
Chr 2: 91389125 - 91390708
Public Clones not available
Private Clones OST95914 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14861
Vector Insertion
Chr 2: 91396790 - 91397731
Public Clones PST3637-NR (escells) PST3637-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16070
Vector Insertion
Chr 2: 91399320 - 91400963
Public Clones not available
Private Clones OST466846 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8026
Vector Insertion
Chr 2: 91401069 - 91402910
Public Clones RRJ074 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4356
Vector Insertion
Chr 2: 91404606 - 91405777
Public Clones AF0301 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5363
Vector Insertion
Chr 2: 91405961 - 91408293
Public Clones CSJ021 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1600
Vector Insertion
Chr 2: 91410430 - 91412504
Public Clones CC0005 (sanger)
Private Clones OST8364 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29083
Vector Insertion
Chr 2: 91412691 - 91413129
Public Clones not available
Private Clones OST9137 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10990
Vector Insertion
Chr 2: 91421396 - 91425878
Public Clones P119C09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5666
Vector Insertion
Chr 2: 91426074 - 91426394
Public Clones CSI617 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15599
Vector Insertion
Chr 2: 91426531 - 91428825
Public Clones PST4632-NL (escells)
Private Clones OST346452 (lexicon) OST337033 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1688
Vector Insertion
Chr 2: 91447790 - 91452896
Public Clones CF0769 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9794
Vector Insertion
Chr 2: 91456618 - 91459844
Public Clones RRC020 (baygenomics) W036C06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111338
Sequence
CTGACCCGGCAGAG - UNI10915 - - UNI30144 - GAACTACTTTTAACTCCAAGAGAAAACTAGAAGCACAATGGGAGATGACAGTGAGTGGT

TGAAATTACCAGTTGATCAGAAATGTGAACACAAG - UNI29035 - CTATGGAAAGCAAGATTAAGTGGGTATGAAGAAGCCTTGAAGATCTTCCAG

AAAATAAAGGATGAAAAGAGTCCAGAATGGTCCAAATACTTAGGATTAATCAAAAAATTTGTCACTGATTCCAATGCAGTGGTTCAATTGAAAGGACTAG

AAGCTGCACTTGTCTATGTTGAAAATGCTCATGTTGCAGGAAA - UNI26812 - AACAACGGGAGAGGTTGTATCAGGTGTTGTAAGTAAAGTCTTC

AACCAACCTAAAGCCAAAGCCAAGGAACTGGGCATAGAGATTTGCCTCATGTATGTTGAGATTGAAAAAGGAGAGTCTGTACAAGAAGAGCTTCTGAAGG

GCCTGGATAACAAGAACCCCAAGATCATAGTGGCCTGTATAGAAACACTGAGGAAAGCCTTAAG TGAATTTGGTTCCAAAATCATCTCACTTAAGCCAA

TTATTAAAGTGTTGCCAAAACTATTTGAATCTCGAGACAAGGCTGTTCGGGATGAAGCCAAATTATTTGCTATAGAGATTTATCGATGGAATCGAGATGC

TGTGAAACACACACTACAAAATATAAATTCTGTCCAG TTGAAAGAATTAGAAGAAGAGTGGGTCAAGCTGCCAACAGGTGCTCCTAAGCCCAGTCGGTT

TCTGCGTTCCCAACAAGAACTAGAAGCTAAACTGGAACAGCAACAGTCTGCTGGTGGAGATGCAGAAGGGG - UNI14861 - GTGGTGATGATGGTG

ATGAGGTACCACAGGTAGATGCTTATGAGCTTCTGGATGCGGTAGAGATCCTTTCCAAACTTCCCAAAGACTTTTATGACAAAATT GAGGCAAAGAAAT

GGCAAGAGAGAAAAGAAGCTCTGGAGGCTGTAGAAGTACTAGTGAAAAACCCCAAGCTGGAAGCAGGCGATTACGCAGATTTAGTGAAAGCATTAAAAAA

G - UNI16070 - GTTGTTGGAAAGGACACCAATGTCATGTTGGTAGCTTTGGCAGCAAAATGTCTTACTGGCTTAGCTGTTGGGCTCAGAAAGAAAT

TTGGACAATATGCAGGACAT - UNI8026 - GTTGTGCCAACAATTTTGGAAAAATTCAAAGAAAAGAAGCCTCAAGTGGTACAAGCCCTGCAGGAGG

CAATTGATGCAATCTTCCTCACT ACCACACTACAGAACATCAGTGAGGATGTCTTAGCAGTAATGGATAATAAAAATCCCACCATCAAGCAGCAGACAT

CACTTTTTATTGCAAGAAGCTTTCGTCACTGCACTTCCTCTACATTGCCGAAGAGTCTACTAAAACCCTTTTGTGCTGCTCTACTTAAG CACATCAATG

ATTCTGCTCCTGAAGTCAGAGATGCTGCATTTGAAGCACTGGGTACAGCTTTGAAGGTGGTTGGTGAGAAATCAGTAAACCCATTTTTAGCTGATGTTGA

CAAACTCAAACTTGATAGG - UNI4356 - ATCAAAGAATGTTCAGAAAAAGTAGAACTGGTTCATGGTAAAAAATCTGGACTTGCAACTGAAAAGAA

GGAATCCAAGCCTCTACCTGGAAGGGCTGCAGCATCAGGGGCTGCAGGGGACAAAGACACAAAAGATGTTTCAGGACCCAAACCAGGACCGTTAAAAAAA

ACACCTACTGCTAAG - UNI5363 - GCTGGTGGACCATCTAAGAAAGGTAAAACAACTGCACCAGGTGGCTCAGCAAGTGCCGGGACAAAGAATAAG

AAAGGATTGGAGACCAAAGAAATAGTGGAGCCAGAACTCTCA ATTGAAGTATGTGAAGAGAAAGCTTCAGCTGTTCTTCCCCCAACCTGTATTCAGCTT

CTAGACAGCAGCAACTGGAAGGAAAGGCTGGCCTGTATGGAAGAATTCCAAAAG GCTGTTGAACTAATGGAGCGAACTGAGATGCCGTGCCAGGCATTG

GTGAAGATGCTAGCAAAAAAACCTGGATGGAAAGAAACTAATTTTCAG - UNI1600 - GTGATGCAGATGAAGCTTCACATTGTTGCTTTGATTGCC

CAGAAGGGAAATTTTTCTAAAACGTCTGCTCAGATTGTATTAGATGGCCTTGTAGACAAGATTGGAGATGTGAAATGTGGGAACAATGCAAAAGAAGCCA

TGACAGCAATAGCTGAAGCGTGCATGCTGCCCTGGACAGCTGAGCAG - UNI29083 - GTGATGTCAATGGCCTTCTCACAAAAGAATCCTAAGAAT

CAATCAGAAACTCTAAATTGGCTATCAAATGCAATAAAAGAATTTGGATTTTCTGA GTTGAATGTCAAAGCTTTCATTAGCAACGTGAAGACTGCTCTT

GCTGCAACAAATCCT GCTGTGAGGACTTCTGCCATCACCCTGCTTGGCGTGATGTATCTATATGTTGGTCCTTCTTTGAGAATGATCTTTGAGGATGAG

AAGCCTGCCCTCCTATCCCAGATAGATGCAGAATTTCAAAAG ATGCAGGGACAAAGTCCTCCCGCTCCAACGAGGGGAATTGCTAAGCACAGCACAAGT

GCTACAGATGAAGGAGAAGATGGAGAGGAACCAGGTGAAGGGGGCAATGATGTTGTTGATCTTTTGCCGAGGATTGAGATCAG TGACAAAATTACTTCA

GAGTTGGTGTCTAAGATTGGTGACAAGAATTGGAAGATCAGGAAAGAAGGCCTAGATGAAGTGGCAGGTATTATCAATGAAGCAAAATTTATCCAACCAA

ATATAGGTGAACTTCCAACTGCCTTGAAGGGTCGACTGAATGATTCAAACAAAATCTTG GTGCAGCAGACACTGAATATCCTTCAGCAACTGGCAGTAG

CCATGGGTGCAAACATCAGGCAGCATGTAAAGAACCTGGGCATCCCTGTCATTACTGTTCTCGGAGATAGCAAG AACAATGTTCGAGCTGCTGCCCTAG

CAACTGTGAATGCTTGGGCAGAACAAACTGGCATGAAAGAATGGCTGGAGGGAGAAGATCTTTCTGAAGAACTTAAAAAGGAAAATCCCTTCCTGAGGCA

AGAG - UNI10990 - CTTCTGGGATGGCTGGCAGAGAAACTACCTACACTCCGTTCCACTCCTACAGATCTTATCCTTTGTGTTCCTCATCTGTATT

CCTGTCTAAAAGATCGAAATGGAGATGTACGGAAGAAGGCCCAAGATGCTTTGCCATTCTTTATGATGCATTTAGGATATGAAAAAATGGCTAAGGCTAC

TGGGAAACTAAAG - UNI5666 - CCAACTTCTAAAGATCAAGTACTGGCCATGCTAGAAAAGGCCAAAGCTAACATGCCATCCAAGCCTGCTGCACC

TGCTAAGGCCATGTCCAAACCAATGGGAGGGTCGGCTCCAGCCAAAACCCAGCCTATACCAG - UNI15599 - CACCTGTTGAAGATTCTGTTTCCA

GTACCATAGAAGCTAAGCCTGATCTGAAAAAGGCTAAAGCTCCAGGCGTTTCTTCCAAAGCAAAG AGTGTACAAGGGAAGAAAGTGCCAAGCAAAACCA

CCTTAAAGGAAGACGACGACAAATCTGGTCCTATTTTTATTGTTGTTCCAAATGGAAAGGAGCAAAGGATGAGAGATGAGAAAGGATTAAAG GTGCTAA

AGTGGAATTTTACTACCCCACGGGATGAGTACATTGAACAGCTGAAGACTCAGATGTCTACCTGTGTGGCTAAATGGTTACAGGATGAAATGTTTCACTC

AGATTTCCAGCATCACAATAAAGCCCTAGCTGTCATGGTTGAT CACTTGGAAAGTGAAAAAGACGGTGTCATCAGTTGCTTAGATCTTATCTTAAAATG

GCTTACCCTCCGGTTTTTCGACACCAATACAAGCGTTCTAATGAAAGCACTGGAATATTTAAAATTGCTTTTCACCCTGCTGAGTGAGGAAGAGTATCAT

CTTACTGAGAATGAAGCATCGTCCTTTATCCCCTATCTCATCCTCAAG GTTGGAGAACCAAAGGATGTCATTCGTAAAGATGTCCGTGCTATCCTGAAC

CGGATGTGCCTTGTCTACCCAGCCAGCAAAATGTTCCCCTTCATTATGGAAGGAACCAAGTCCAAAAACTCTAAGCAGAGAGCAG AGTGCCTGGAAGAG

CTAGGTTGCTTAATTGAGTCCTATGGTATGAATGTTTGTCAGCCAACCCCAGGAAAAGCCTTAAAGGAGATAGCTATTCACATAGGAGACCGAGACAATG

CTGTACGGAATGCTGCCCTCAACACCATTGTAACAGTGTACAACGTGCATGGAGATCAGGTGTTCAAACTGATTGGAAAT CTTTCTGAGAAAGACATGA

GCATGCTTGAGGAGAGGATAAAGCGGTCAGCAAAGAGACCCTCTGCTGCACCTGTGAAACAGGCCGAAGAGAAACCTCAGCGCACACAGAATATAAACTC

TAATGCCAACATGCTACGCAAGGGACCAGCTGAGGATATGTCCTCCAAACTTAA TCAAGCTCGAAGCCTGAGTGGGCATCCTGAAGCAGCCCAGATGGT

TCGCCGAGAATTCCAGCTGGATTTAGATGAGATTGAAAATGATAATGGTACAGTCCGCTGTGAAATGCCAGAGCTTGTCCAGCACAAACTTGATGACATT

TTTGAACCTGTCCTTATTCCTGAACCTAA GATCCGGGCTGTTTCTCCACATTTTGATGACATGCACAGTAATACAGCATCCACAATCAATTTCATTATC

TCCCAAGTAGCCAGTGGTGACATCAACACAAGCATCCAAGCTCTGACACAG ATTGATGAGGTCCTGAGGCAGGAAGACAAAGCTGAAGCTATGTCTGGC

CACATTGATCAGTTTCTGATAGCAACATTCATGCAGCTAAGACTCATCTACAGCACACACATGGCAGATGAGAAGTTGGACAAGGATGAAATCATCAAGT

TGTATAGCTGTATCATTGGCAACATGATTTCG CTATTTCAGATAGAGAGCTTGGCCCGGGAGGCCTCCACTGGAGTACTGAAAGACCTGATGCATGGAC

TGATCACCTTAATGCTGGATTCTCGGATTGAAGATCTGGAGGAAGGACAACAGGTGATTCGTTCTGTGAACCTCTTGGTGGTGAAGGTTTTGGAGAAATC

AGACCAGACCAATATCCTCAG - UNI1688 - TGCCCTGCTTGTTTTACTTCAGGACAGCCTGCTAGCAACAGCTAGTTCTCCCAAATTCTCAGAGCT

TGTTATGAAG TGTCTATGGAGAATGGTTCGACTATTACCTGACACCATCAACAGCATTAACCTAGACAGAATTCTTCTGGACATCCACATTTTCATGAA

GGTCTTTCCCAAAGAGAAATTGAAGCAATGCAAAAGTGAATTTCCTATAAGGACTCTAAAGACCCTTCTACATACTTTATGCAAATTAAAAGGACCTAAA

 ATCCTAGACCACCTTACAATGATTGATAATAAGAATGAGTCAGAATTGGAGGCCCACCTGTGTCGGATGATGAAGCATAGTATGGACCAGACTGGGAGC

AAGTCTGATAAGGAAACAGAAAAGGGAGCTTCTCGAATA GATGAAAAATCATCAAAGGCCAAAGTAAATGATTTCTTAGCTGAGATTTTTAAGAAGATT

GGCTCCAAAGAGAACACTAAGGAG GGCCTAGCAGAGTTATATGAATATAAGAAGAAATATTCAGATACTGACATTGAACCATTTCTGAAAAATTCCTCG

CAGTTCTTTCAGAGTTATGTTGAGAGAGGCCTTCGGGTGATTGAGATGGAGAGAGAAAGCAAAGGCCGGATTCCTACTTCAACAG - UNI9794 - GC

ATTTCCCCTCAGATGGAGGTCACATGTGTGCCCACCCCCACAAGCACAGTGTCCTCCCTAGGTAACACAAATGGAGAAGAAGTGGGGCCATCTGTCTACT

TGGAAAGGCTAAAAATTCTGCGGCAGCGGTGTGGTCTTGACAACACAAAG CAAGATGACCGGCCTCCACTGACCTCTTTGCTCTCCAAACCAGCAATTC

CTCCAGTTGCCTCCTCCACAGACATGCTCCATAGCAAGCTCTCACAGCTCCGGGAGTCCCGGGAACAGCACCAGCACTCAGACCTGGATTCCAACCAGAC

CCACTCTGCAGGAACCATGACCTCCTCCTCCTCCACAACTAACATTGATGACTTGAAAAAGAGACTGGAGAGAATAAAGAGCAGTCGCAAATGAAGCTGC

CCACCCTCGGCACTCTGCAGCTTTAGTTACTGATCTAGAAGCCCTGTAGTGTGAAGCGGCCGCTGCAGGCCATTGTACACAAACTGGTTGTATGTATCAG

ACTGCAGATGGGAGGAGCAGTGGTGCCTCAAGTCTGCACATGCTCTGCTTCTAGAAGACTGACTGTGGATTAGCTTAGTGTACAGACTTTAAACAGCTGC

TCCCTCAGCTCAGAGTAGGTTCCATATCCTTTTTTTTTGTTTTGTTTTAATGGCTCATTTGTAAAATTGTCCTAATTTTTCCTAGCTTTCAGCCATTAGA

AACTCTTTTAATAGTTCCTTTTGAGTTGTGAGCTCTTCTTCTGTAGCCCTGAAGGGACACTGTATTCTGTATGAATGCATGGCATGAGACAACTAATTTA

AGAGACTTTTATAAATAAAGTTTGCATTAACT
Translation
 - UNI10915 - - UNI30144 - MGDDSEWLKLPVDQKCEHK - UNI29035 - LWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTD

SNAVVQLKGLEAALVYVENAHVAGK - UNI26812 - KTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVAC

IETLRKALS SEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRWNRDAVKHTLQNINSVQ LKELEEEWVKLPTGAPKPSRFLRSQQELEAK

LEQQQSAGGDAEGG - UNI14861 - GGDDGDEVPQVDAYELLDAVEILSKLPKDFYDKI EAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALK

K - UNI16070 - VVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGH - UNI8026 - VVPTILEKFKEKKPQVVQALQEAIDAIFLT TTLQNI

SEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLK HINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDR - UNI4

356 - IKECSEKVELVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAK - UNI5363 - AGGPSKKGKTTAPGGSASAG

TKNKKGLETKEIVEPELS IEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQK AVELMERTEMPCQALVKMLAKKPGWKETNFQ - UNI1600 -

 VMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQ - UNI29083 - VMSMAFSQKNPKNQSETLNWLSN

AIKEFGFSE ELNVKAFISNVKTALAATNP AVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQK MQGQSPPAPTRGIAKHSTSATDEGED

GEEPGEGGNDVVDLLPRIEIS SDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLNDSNKIL VQQTLNILQQLAVAMGAN

IRQHVKNLGIPVITVLGDSK NNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQE - UNI10990 - LLGWLAEKLPTLRSTPTDLILC

VPHLYSCLKDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLK - UNI5666 - PTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPI

PA - UNI15599 - APVEDSVSSTIEAKPDLKKAKAPGVSSKAK SVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLK VLKWNFTTPR

DEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVD HLESEKDGVISCLDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLSEEEYHLTENEAS

SFIPYLILK VGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAE ECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNA

ALNTIVTVYNVHGDQVFKLIGN LSEKDMSMLEERIKRSAKRPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLN NQARSLSGHPEAAQMVRR

EFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPK KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQ IDEVLRQEDKAEAMSG

HIDQFLIATFMQLRLIYSTHMADEKLDKDEIIKLYSCIIGNMIS LFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEK

SDQTNILS - UNI1688 - SALLVLLQDSLLATASSPKFSELVMK CLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQCKSEFPIRTLKTL

LHTLCKLKGPK ILDHLTMIDNKNESELEAHLCRMMKHSMDQTGSKSDKETEKGASRI DEKSSKAKVNDFLAEIFKKIGSKENTKE GLAELYEYKKKY

SDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTG - UNI9794 - GISPQMEVTCVPTPTSTVSSLGNTNGEEVGPSVYLERLKILRQRC

GLDNTK QDDRPPLTSLLSKPAIPPVASSTDMLHSKLSQLRESREQHQHSDLDSNQTHSAGTMTSSSSTTNIDDLKKRLERIKSSRK
Transcript ENSMUST00000046769
Sequence
CTGACCCGGCAGAG - UNI10915 - - UNI30144 - GAACTACTTTTAACTCCAAGAGAAAACTAGAAGCACAATGGGAGATGACAGTGAGTGGT

TGAAATTACCAGTTGATCAGAAATGTGAACACAAG - UNI29035 - CTATGGAAAGCAAGATTAAGTGGGTATGAAGAAGCCTTGAAGATCTTCCAG

AAAATAAAGGATGAAAAGAGTCCAGAATGGTCCAAATACTTAGGATTAATCAAAAAATTTGTCACTGATTCCAATGCAGTGGTTCAATTGAAAGGACTAG

AAGCTGCACTTGTCTATGTTGAAAATGCTCATGTTGCAGGAAA - UNI26812 - AACAACGGGAGAGGTTGTATCAGGTGTTGTAAGTAAAGTCTTC

AACCAACCTAAAGCCAAAGCCAAGGAACTGGGCATAGAGATTTGCCTCATGTATGTTGAGATTGAAAAAGGAGAGTCTGTACAAGAAGAGCTTCTGAAGG

GCCTGGATAACAAGAACCCCAAGATCATAGTGGCCTGTATAGAAACACTGAGGAAAGCCTTAAG TGAATTTGGTTCCAAAATCATCTCACTTAAGCCAA

TTATTAAAGTGTTGCCAAAACTATTTGAATCTCGAGACAAGGCTGTTCGGGATGAAGCCAAATTATTTGCTATAGAGATTTATCGATGGAATCGAGATGC

TGTGAAACACACACTACAAAATATAAATTCTGTCCAG TTGAAAGAATTAGAAGAAGAGTGGGTCAAGCTGCCAACAGGTGCTCCTAAGCCCAGTCGGTT

TCTGCGTTCCCAACAAGAACTAGAAGCTAAACTGGAACAGCAACAGTCTGCTGGTGGAGATGCAGAAGGGG - UNI14861 - GTGGTGATGATGGTG

ATGAGGTACCACAGGTAGATGCTTATGAGCTTCTGGATGCGGTAGAGATCCTTTCCAAACTTCCCAAAGACTTTTATGACAAAATT GAGGCAAAGAAAT

GGCAAGAGAGAAAAGAAGCTCTGGAGGCTGTAGAAGTACTAGTGAAAAACCCCAAGCTGGAAGCAGGCGATTACGCAGATTTAGTGAAAGCATTAAAAAA

G - UNI16070 - GTTGTTGGAAAGGACACCAATGTCATGTTGGTAGCTTTGGCAGCAAAATGTCTTACTGGCTTAGCTGTTGGGCTCAGAAAGAAAT

TTGGACAATATGCAGGACAT - UNI8026 - GTTGTGCCAACAATTTTGGAAAAATTCAAAGAAAAGAAGCCTCAAGTGGTACAAGCCCTGCAGGAGG

CAATTGATGCAATCTTCCTCACT ACCACACTACAGAACATCAGTGAGGATGTCTTAGCAGTAATGGATAATAAAAATCCCACCATCAAGCAGCAGACAT

CACTTTTTATTGCAAGAAGCTTTCGTCACTGCACTTCCTCTACATTGCCGAAGAGTCTACTAAAACCCTTTTGTGCTGCTCTACTTAAG CACATCAATG

ATTCTGCTCCTGAAGTCAGAGATGCTGCATTTGAAGCACTGGGTACAGCTTTGAAGGTGGTTGGTGAGAAATCAGTAAACCCATTTTTAGCTGATGTTGA

CAAACTCAAACTTGATAGG - UNI4356 - ATCAAAGAATGTTCAGAAAAAGTAGAACTGGTTCATGGTAAAAAATCTGGACTTGCAACTGAAAAGAA

GGAATCCAAGCCTCTACCTGGAAGGGCTGCAGCATCAGGGGCTGCAGGGGACAAAGACACAAAAGATGTTTCAGGACCCAAACCAGGACCGTTAAAAAAA

ACACCTACTGCTAAG - UNI5363 - GCTGGTGGACCATCTAAGAAAGGTAAAACAACTGCACCAGGTGGCTCAGCAAGTGCCGGGACAAAGAATAAG

AAAGGATTGGAGACCAAAGAAATAGTGGAGCCAGAACTCTCA ATTGAAGTATGTGAAGAGAAAGCTTCAGCTGTTCTTCCCCCAACCTGTATTCAGCTT

CTAGACAGCAGCAACTGGAAGGAAAGGCTGGCCTGTATGGAAGAATTCCAAAAG GCTGTTGAACTAATGGAGCGAACTGAGATGCCGTGCCAGGCATTG

GTGAAGATGCTAGCAAAAAAACCTGGATGGAAAGAAACTAATTTTCAG - UNI1600 - GTGATGCAGATGAAGCTTCACATTGTTGCTTTGATTGCC

CAGAAGGGAAATTTTTCTAAAACGTCTGCTCAGATTGTATTAGATGGCCTTGTAGACAAGATTGGAGATGTGAAATGTGGGAACAATGCAAAAGAAGCCA

TGACAGCAATAGCTGAAGCGTGCATGCTGCCCTGGACAGCTGAGCAG - UNI29083 - GTGATGTCAATGGCCTTCTCACAAAAGAATCCTAAGAAT

CAATCAGAAACTCTAAATTGGCTATCAAATGCAATAAAAGAATTTGGATTTTCTGA GTTGAATGTCAAAGCTTTCATTAGCAACGTGAAGACTGCTCTT

GCTGCAACAAATCCT GCTGTGAGGACTTCTGCCATCACCCTGCTTGGCGTGATGTATCTATATGTTGGTCCTTCTTTGAGAATGATCTTTGAGGATGAG

AAGCCTGCCCTCCTATCCCAGATAGATGCAGAATTTCAAAAG ATGCAGGGACAAAGTCCTCCCGCTCCAACGAGGGGAATTGCTAAGCACAGCACAAGT

GCTACAGATGAAGGAGAAGATGGAGAGGAACCAGGTGAAGGGGGCAATGATGTTGTTGATCTTTTGCCGAGGATTGAGATCAG TGACAAAATTACTTCA

GAGTTGGTGTCTAAGATTGGTGACAAGAATTGGAAGATCAGGAAAGAAGGCCTAGATGAAGTGGCAGGTATTATCAATGAAGCAAAATTTATCCAACCAA

ATATAGGTGAACTTCCAACTGCCTTGAAGGGTCGACTGAATGATTCAAACAAAATCTTG GTGCAGCAGACACTGAATATCCTTCAGCAACTGGCAGTAG

CCATGGGTGCAAACATCAGGCAGCATGTAAAGAACCTGGGCATCCCTGTCATTACTGTTCTCGGAGATAGCAAG AACAATGTTCGAGCTGCTGCCCTAG

CAACTGTGAATGCTTGGGCAGAACAAACTGGCATGAAAGAATGGCTGGAGGGAGAAGATCTTTCTGAAGAACTTAAAAAGGAAAATCCCTTCCTGAGGCA

AGAG - UNI10990 - CTTCTGGGATGGCTGGCAGAGAAACTACCTACACTCCGTTCCACTCCTACAGATCTTATCCTTTGTGTTCCTCATCTGTATT

CCTGTCTAAAAGATCGAAATGGAGATGTACGGAAGAAGGCCCAAGATGCTTTGCCATTCTTTATGATGCATTTAGGATATGAAAAAATGGCTAAGGCTAC

TGGGAAACTAAAG - UNI5666 - CCAACTTCTAAAGATCAAGTACTGGCCATGCTAGAAAAGGCCAAAGCTAACATGCCATCCAAGCCTGCTGCACC

TGCTAAGGCCATGTCCAAACCAATGGGAGGGTCGGCTCCAGCCAAAACCCAGCCTATACCAG - UNI15599 - CACCTGTTGAAGATTCTGTTTCCA

GTACCATAGAAGCTAAGCCTGATCTGAAAAAGGCTAAAGCTCCAGGCGTTTCTTCCAAAGCAAAG AGTGTACAAGGGAAGAAAGTGCCAAGCAAAACCA

CCTTAAAGGAAGACGACGACAAATCTGGTCCTATTTTTATTGTTGTTCCAAATGGAAAGGAGCAAAGGATGAGAGATGAGAAAGGATTAAAG GTGCTAA

AGTGGAATTTTACTACCCCACGGGATGAGTACATTGAACAGCTGAAGACTCAGATGTCTACCTGTGTGGCTAAATGGTTACAGGATGAAATGTTTCACTC

AGATTTCCAGCATCACAATAAAGCCCTAGCTGTCATGGTTGAT CACTTGGAAAGTGAAAAAGACGGTGTCATCAGTTGCTTAGATCTTATCTTAAAATG

GCTTACCCTCCGGTTTTTCGACACCAATACAAGCGTTCTAATGAAAGCACTGGAATATTTAAAATTGCTTTTCACCCTGCTGAGTGAGGAAGAGTATCAT

CTTACTGAGAATGAAGCATCGTCCTTTATCCCCTATCTCATCCTCAAG GTTGGAGAACCAAAGGATGTCATTCGTAAAGATGTCCGTGCTATCCTGAAC

CGGATGTGCCTTGTCTACCCAGCCAGCAAAATGTTCCCCTTCATTATGGAAGGAACCAAGTCCAAAAACTCTAAGCAGAGAGCAG AGTGCCTGGAAGAG

CTAGGTTGCTTAATTGAGTCCTATGGTATGAATGTTTGTCAGCCAACCCCAGGAAAAGCCTTAAAGGAGATAGCTATTCACATAGGAGACCGAGACAATG

CTGTACGGAATGCTGCCCTCAACACCATTGTAACAGTGTACAACGTGCATGGAGATCAGGTGTTCAAACTGATTGGAAAT CTTTCTGAGAAAGACATGA

GCATGCTTGAGGAGAGGATAAAGCGGTCAGCAAAGAGACCCTCTGCTGCACCTGTGAAACAGGCCGAAGAGAAACCTCAGCGCACACAGAATATAAACTC

TAATGCCAACATGCTACGCAAGGGACCAGCTGAGGATATGTCCTCCAAACTTAA TCAAGCTCGAAGCCTGAGTGGGCATCCTGAAGCAGCCCAGATGGT

TCGCCGAGAATTCCAGCTGGATTTAGATGAGATTGAAAATGATAATGGTACAGTCCGCTGTGAAATGCCAGAGCTTGTCCAGCACAAACTTGATGACATT

TTTGAACCTGTCCTTATTCCTGAACCTAA GATCCGGGCTGTTTCTCCACATTTTGATGACATGCACAGTAATACAGCATCCACAATCAATTTCATTATC

TCCCAAGTAGCCAGTGGTGACATCAACACAAGCATCCAAGCTCTGACACAG ATTGATGAGGTCCTGAGGCAGGAAGACAAAGCTGAAGCTATGTCTGGC

CACATTGATCAGTTTCTGATAGCAACATTCATGCAGCTAAGACTCATCTACAGCACACACATGGCAGATGAGAAGTTGGACAAGGATGAAATCATCAAGT

TGTATAGCTGTATCATTGGCAACATGATTTCG CTATTTCAGATAGAGAGCTTGGCCCGGGAGGCCTCCACTGGAGTACTGAAAGACCTGATGCATGGAC

TGATCACCTTAATGCTGGATTCTCGGATTGAAGATCTGGAGGAAGGACAACAGGTGATTCGTTCTGTGAACCTCTTGGTGGTGAAGGTTTTGGAGAAATC

AGACCAGACCAATATCCTCAG - UNI1688 - TGCCCTGCTTGTTTTACTTCAGGACAGCCTGCTAGCAACAGCTAGTTCTCCCAAATTCTCAGAGCT

TGTTATGAAG TGTCTATGGAGAATGGTTCGACTATTACCTGACACCATCAACAGCATTAACCTAGACAGAATTCTTCTGGACATCCACATTTTCATGAA

GGTCTTTCCCAAAGAGAAATTGAAGCAATGCAAAAGTGAATTTCCTATAAGGACTCTAAAGACCCTTCTACATACTTTATGCAAATTAAAAGGACCTAAA

 ATCCTAGACCACCTTACAATGATTGATAATAAGAATGAGTCAGAATTGGAGGCCCACCTGTGTCGGATGATGAAGCATAGTATGGACCAGACTGGGAGC

AAGTCTGATAAGGAAACAGAAAAGGGAGCTTCTCGAATA GATGAAAAATCATCAAAGGCCAAAGTAAATGATTTCTTAGCTGAGATTTTTAAGAAGATT

GGCTCCAAAGAGAACACTAAGGAG GGCCTAGCAGAGTTATATGAATATAAGAAGAAATATTCAGATACTGACATTGAACCATTTCTGAAAAATTCCTCG

CAGTTCTTTCAGAGTTATGTTGAGAGAGGCCTTCGGGTGATTGAGATGGAGAGAGAAAGCAAAGGCCGGATTCCTACTTCAACAG - UNI9794 - GT

AACACAAATGGAGAAGAAGTGGGGCCATCTGTCTACTTGGAAAGGCTAAAAATTCTGCGGCAGCGGTGTGGTCTTGACAACACAAAG CAAGATGACCGG

CCTCCACTGACCTCTTTGCTCTCCAAACCAGCAATTCCTCCAGTTGCCTCCTCCACAGACATGCTCCATAGCAAGCTCTCACAGCTCCGGGAGTCCCGGG

AACAGCACCAGCACTCAGACCTGGATTCCAACCAGACCCACTCTGCAGGAACCATGACCTCCTCCTCCTCCACAACTAACATTGATGACTTGAAAAAGAG

ACTGGAGAGAATAAAGAGCAGTCGCAAATGAAGCTGCCCACCCTCGGCACTCTGCAGCTTTAGTTACTGATCTAGAAGCCCTGTAGTGTGAAGCGGCCGC

TGCAGGCCATTGTACACAAACTGGTTGTATGTATCAGACTGCAGATGGGAGGAGCAGTGGTGCCTCAAGTCTGCACATGCTCTGCTTCTAGAAGACTGAC

TGTGGATTAGCTTAGTGTACAGACTTTAAACAGCTGCTCCCTCAGCTCAGAGTAGGTTCCATATCCTTTTTTTTTGTTTTGTTTTAATGGCTCATTTGTA

AAATTGTCCTAATTTTTCCTAGCTTTCAGCCATTAGAAACTCTTTTAATAGTTCCTTTTGAGTTGTGAGCTCTTCTTCTGTAGCCCTGAAGGGACACTGT

ATTCTGTATGAATGCATGGCATGAGACAACTAATTTAAGAGACTTTTATAAATAAAGTTTGCATTAACT
Translation
 - UNI10915 - - UNI30144 - MGDDSEWLKLPVDQKCEHK - UNI29035 - LWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTD

SNAVVQLKGLEAALVYVENAHVAGK - UNI26812 - KTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVAC

IETLRKALS SEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRWNRDAVKHTLQNINSVQ LKELEEEWVKLPTGAPKPSRFLRSQQELEAK

LEQQQSAGGDAEGG - UNI14861 - GGDDGDEVPQVDAYELLDAVEILSKLPKDFYDKI EAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALK

K - UNI16070 - VVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGH - UNI8026 - VVPTILEKFKEKKPQVVQALQEAIDAIFLT TTLQNI

SEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLK HINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDR - UNI4

356 - IKECSEKVELVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAK - UNI5363 - AGGPSKKGKTTAPGGSASAG

TKNKKGLETKEIVEPELS IEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQK AVELMERTEMPCQALVKMLAKKPGWKETNFQ - UNI1600 -

 VMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQ - UNI29083 - VMSMAFSQKNPKNQSETLNWLSN

AIKEFGFSE ELNVKAFISNVKTALAATNP AVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQK MQGQSPPAPTRGIAKHSTSATDEGED

GEEPGEGGNDVVDLLPRIEIS SDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLNDSNKIL VQQTLNILQQLAVAMGAN

IRQHVKNLGIPVITVLGDSK NNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQE - UNI10990 - LLGWLAEKLPTLRSTPTDLILC

VPHLYSCLKDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLK - UNI5666 - PTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPI

PA - UNI15599 - APVEDSVSSTIEAKPDLKKAKAPGVSSKAK SVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLK VLKWNFTTPR

DEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVD HLESEKDGVISCLDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLSEEEYHLTENEAS

SFIPYLILK VGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAE ECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNA

ALNTIVTVYNVHGDQVFKLIGN LSEKDMSMLEERIKRSAKRPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLN NQARSLSGHPEAAQMVRR

EFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPK KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQ IDEVLRQEDKAEAMSG

HIDQFLIATFMQLRLIYSTHMADEKLDKDEIIKLYSCIIGNMIS LFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEK

SDQTNILS - UNI1688 - SALLVLLQDSLLATASSPKFSELVMK CLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQCKSEFPIRTLKTL

LHTLCKLKGPK ILDHLTMIDNKNESELEAHLCRMMKHSMDQTGSKSDKETEKGASRI DEKSSKAKVNDFLAEIFKKIGSKENTKE GLAELYEYKKKY

SDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTG - UNI9794 - GNTNGEEVGPSVYLERLKILRQRCGLDNTK QDDRPPLTSLLSKP

AIPPVASSTDMLHSKLSQLRESREQHQHSDLDSNQTHSAGTMTSSSSTTNIDDLKKRLERIKSSRK
Transcript ENSMUST00000099716
Sequence
CTGACCCGGCAGAG - UNI10915 - - UNI30144 - GAACTACTTTTAACTCCAAGAGAAAACTAGAAGCACAATGGGAGATGACAGTGAGTGGT

TGAAATTACCAGTTGATCAGAAATGTGAACACAAG - UNI29035 - CTATGGAAAGCAAGATTAAGTGGGTATGAAGAAGCCTTGAAGATCTTCCAG

AAAATAAAGGATGAAAAGAGTCCAGAATGGTCCAAATACTTAGGATTAATCAAAAAATTTGTCACTGATTCCAATGCAGTGGTTCAATTGAAAGGACTAG

AAGCTGCACTTGTCTATGTTGAAAATGCTCATGTTGCAGGAAA - UNI26812 - AACAACGGGAGAGGTTGTATCAGGTGTTGTAAGTAAAGTCTTC

AACCAACCTAAAGCCAAAGCCAAGGAACTGGGCATAGAGATTTGCCTCATGTATGTTGAGATTGAAAAAGGAGAGTCTGTACAAGAAGAGCTTCTGAAGG

GCCTGGATAACAAGAACCCCAAGATCATAGTGGCCTGTATAGAAACACTGAGGAAAGCCTTAAG TGAATTTGGTTCCAAAATCATCTCACTTAAGCCAA

TTATTAAAGTGTTGCCAAAACTATTTGAATCTCGAGACAAGGCTGTTCGGGATGAAGCCAAATTATTTGCTATAGAGATTTATCGATGGAATCGAGATGC

TGTGAAACACACACTACAAAATATAAATTCTGTCCAG TTGAAAGAATTAGAAGAAGAGTGGGTCAAGCTGCCAACAGGTGCTCCTAAGCCCAGTCGGTT

TCTGCGTTCCCAACAAGAACTAGAAGCTAAACTGGAACAGCAACAGTCTGCTGGTGGAGATGCAGAAGGGG - UNI14861 - GTGGTGATGATGGTG

ATGAGGTACCACAGGTAGATGCTTATGAGCTTCTGGATGCGGTAGAGATCCTTTCCAAACTTCCCAAAGACTTTTATGACAAAATT GAGGCAAAGAAAT

GGCAAGAGAGAAAAGAAGCTCTGGAGGCTGTAGAAGTACTAGTGAAAAACCCCAAGCTGGAAGCAGGCGATTACGCAGATTTAGTGAAAGCATTAAAAAA

G - UNI16070 - GTTGTTGGAAAGGACACCAATGTCATGTTGGTAGCTTTGGCAGCAAAATGTCTTACTGGCTTAGCTGTTGGGCTCAGAAAGAAAT

TTGGACAATATGCAGGACAT - UNI8026 - GTTGTGCCAACAATTTTGGAAAAATTCAAAGAAAAGAAGCCTCAAGTGGTACAAGCCCTGCAGGAGG

CAATTGATGCAATCTTCCTCACT ACCACACTACAGAACATCAGTGAGGATGTCTTAGCAGTAATGGATAATAAAAATCCCACCATCAAGCAGCAGACAT

CACTTTTTATTGCAAGAAGCTTTCGTCACTGCACTTCCTCTACATTGCCGAAGAGTCTACTAAAACCCTTTTGTGCTGCTCTACTTAAG CACATCAATG

ATTCTGCTCCTGAAGTCAGAGATGCTGCATTTGAAGCACTGGGTACAGCTTTGAAGGTGGTTGGTGAGAAATCAGTAAACCCATTTTTAGCTGATGTTGA

CAAACTCAAACTTGATAGG - UNI4356 - ATCAAAGAATGTTCAGAAAAAGTAGAACTGGTTCATGGTAAAAAATCTGGACTTGCAACTGAAAAGAA

GGAATCCAAGCCTCTACCTGGAAGGGCTGCAGCATCAGGGGCTGCAGGGGACAAAGACACAAAAGATGTTTCAGGACCCAAACCAGGACCGTTAAAAAAA

ACACCTACTGCTAAG - UNI5363 - GCTGGTGGACCATCTAAGAAAGGTAAAACAACTGCACCAGGTGGCTCAGCAAGTGCCGGGACAAAGAATAAG

AAAGGATTGGAGACCAAAGAAATAGTGGAGCCAGAACTCTCA ATTGAAGTATGTGAAGAGAAAGCTTCAGCTGTTCTTCCCCCAACCTGTATTCAGCTT

CTAGACAGCAGCAACTGGAAGGAAAGGCTGGCCTGTATGGAAGAATTCCAAAAG GCTGTTGAACTAATGGAGCGAACTGAGATGCCGTGCCAGGCATTG

GTGAAGATGCTAGCAAAAAAACCTGGATGGAAAGAAACTAATTTTCAG - UNI1600 - GTGATGCAGATGAAGCTTCACATTGTTGCTTTGATTGCC

CAGAAGGGAAATTTTTCTAAAACGTCTGCTCAGATTGTATTAGATGGCCTTGTAGACAAGATTGGAGATGTGAAATGTGGGAACAATGCAAAAGAAGCCA

TGACAGCAATAGCTGAAGCGTGCATGCTGCCCTGGACAGCTGAGCAG - UNI29083 - GTGATGTCAATGGCCTTCTCACAAAAGAATCCTAAGAAT

CAATCAGAAACTCTAAATTGGCTATCAAATGCAATAAAAGAATTTGGATTTTCTGA GTTGAATGTCAAAGCTTTCATTAGCAACGTGAAGACTGCTCTT

GCTGCAACAAATCCT GCTGTGAGGACTTCTGCCATCACCCTGCTTGGCGTGATGTATCTATATGTTGGTCCTTCTTTGAGAATGATCTTTGAGGATGAG

AAGCCTGCCCTCCTATCCCAGATAGATGCAGAATTTCAAAAG ATGCAGGGACAAAGTCCTCCCGCTCCAACGAGGGGAATTGCTAAGCACAGCACAAGT

GCTACAGATGAAGGAGAAGATGGAGAGGAACCAGGTGAAGGGGGCAATGATGTTGTTGATCTTTTGCCGAGGATTGAGATCAG TGACAAAATTACTTCA

GAGTTGGTGTCTAAGATTGGTGACAAGAATTGGAAGATCAGGAAAGAAGGCCTAGATGAAGTGGCAGGTATTATCAATGAAGCAAAATTTATCCAACCAA

ATATAGGTGAACTTCCAACTGCCTTGAAGGGTCGACTGAATGATTCAAACAAAATCTTG GTGCAGCAGACACTGAATATCCTTCAGCAACTGGCAGTAG

CCATGGGTGCAAACATCAGGCAGCATGTAAAGAACCTGGGCATCCCTGTCATTACTGTTCTCGGAGATAGCAAG AACAATGTTCGAGCTGCTGCCCTAG

CAACTGTGAATGCTTGGGCAGAACAAACTGGCATGAAAGAATGGCTGGAGGGAGAAGATCTTTCTGAAGAACTTAAAAAGGAAAATCCCTTCCTGAGGCA

AGAG - UNI10990 - CTTCTGGGATGGCTGGCAGAGAAACTACCTACACTCCGTTCCACTCCTACAGATCTTATCCTTTGTGTTCCTCATCTGTATT

CCTGTCTAAAAGATCGAAATGGAGATGTACGGAAGAAGGCCCAAGATGCTTTGCCATTCTTTATGATGCATTTAGGATATGAAAAAATGGCTAAGGCTAC

TGGGAAACTAAAG - UNI5666 - CCAACTTCTAAAGATCAAGTACTGGCCATGCTAGAAAAGGCCAAAGCTAACATGCCATCCAAGCCTGCTGCACC

TGCTAAGGCCATGTCCAAACCAATGGGAGGGTCGGCTCCAGCCAAAACCCAGCCTATACCAG - UNI15599 - CACCTGTTGAAGATTCTGTTTCCA

GTACCATAGAAGCTAAGCCTGATCTGAAAAAGGCTAAAGCTCCAGGCGTTTCTTCCAAAGCAAAG AGTGTACAAGGGAAGAAAGTGCCAAGCAAAACCA

CCTTAAAGGAAGACGACGACAAATCTGGTCCTATTTTTATTGTTGTTCCAAATGGAAAGGAGCAAAGGATGAGAGATGAGAAAGGATTAAAG GTGCTAA

AGTGGAATTTTACTACCCCACGGGATGAGTACATTGAACAGCTGAAGACTCAGATGTCTACCTGTGTGGCTAAATGGTTACAGGATGAAATGTTTCACTC

AGATTTCCAGCATCACAATAAAGCCCTAGCTGTCATGGTTGAT CACTTGGAAAGTGAAAAAGACGGTGTCATCAGTTGCTTAGATCTTATCTTAAAATG

GCTTACCCTCCGGTTTTTCGACACCAATACAAGCGTTCTAATGAAAGCACTGGAATATTTAAAATTGCTTTTCACCCTGCTGAGTGAGGAAGAGTATCAT

CTTACTGAGAATGAAGCATCGTCCTTTATCCCCTATCTCATCCTCAAG GTTGGAGAACCAAAGGATGTCATTCGTAAAGATGTCCGTGCTATCCTGAAC

CGGATGTGCCTTGTCTACCCAGCCAGCAAAATGTTCCCCTTCATTATGGAAGGAACCAAGTCCAAAAACTCTAAGCAGAGAGCAG AGTGCCTGGAAGAG

CTAGGTTGCTTAATTGAGTCCTATGGTATGAATGTTTGTCAGCCAACCCCAGGAAAAGCCTTAAAGGAGATAGCTATTCACATAGGAGACCGAGACAATG

CTGTACGGAATGCTGCCCTCAACACCATTGTAACAGTGTACAACGTGCATGGAGATCAGGTGTTCAAACTGATTGGAAAT CTTTCTGAGAAAGACATGA

GCATGCTTGAGGAGAGGATAAAGCGGTCAGCAAAGAGACCCTCTGCTGCACCTGTGAAACAGGCCGAAGAGAAACCTCAGCGCACACAGAATATAAACTC

TAATGCCAACATGCTACGCAAGGGACCAGCTGAGGATATGTCCTCCAAACTTAA TCAAGCTCGAAGCCTGAGTGGGCATCCTGAAGCAGCCCAGATGGT

TCGCCGAGAATTCCAGCTGGATTTAGATGAGATTGAAAATGATAATGGTACAGTCCGCTGTGAAATGCCAGAGCTTGTCCAGCACAAACTTGATGACATT

TTTGAACCTGTCCTTATTCCTGAACCTAA GATCCGGGCTGTTTCTCCACATTTTGATGACATGCACAGTAATACAGCATCCACAATCAATTTCATTATC

TCCCAAGTAGCCAGTGGTGACATCAACACAAGCATCCAAGCTCTGACACAG CTATTTCAGATAGAGAGCTTGGCCCGGGAGGCCTCCACTGGAGTACTG

AAAGACCTGATGCATGGACTGATCACCTTAATGCTGGATTCTCGGATTGAAGATCTGGAGGAAGGACAACAGGTGATTCGTTCTGTGAACCTCTTGGTGG

TGAAGGTTTTGGAGAAATCAGACCAGACCAATATCCTCAG - UNI1688 - TGCCCTGCTTGTTTTACTTCAGGACAGCCTGCTAGCAACAGCTAGTT

CTCCCAAATTCTCAGAGCTTGTTATGAAG TGTCTATGGAGAATGGTTCGACTATTACCTGACACCATCAACAGCATTAACCTAGACAGAATTCTTCTGG

ACATCCACATTTTCATGAAGGTCTTTCCCAAAGAGAAATTGAAGCAATGCAAAAGTGAATTTCCTATAAGGACTCTAAAGACCCTTCTACATACTTTATG

CAAATTAAAAGGACCTAAA ATCCTAGACCACCTTACAATGATTGATAATAAGAATGAGTCAGAATTGGAGGCCCACCTGTGTCGGATGATGAAGCATAG

TATGGACCAGACTGGGAGCAAGTCTGATAAGGAAACAGAAAAGGGAGCTTCTCGAATA GATGAAAAATCATCAAAGGCCAAAGTAAATGATTTCTTAGC

TGAGATTTTTAAGAAGATTGGCTCCAAAGAGAACACTAAGGAG GGCCTAGCAGAGTTATATGAATATAAGAAGAAATATTCAGATACTGACATTGAACC

ATTTCTGAAAAATTCCTCGCAGTTCTTTCAGAGTTATGTTGAGAGAGGCCTTCGGGTGATTGAGATGGAGAGAGAAAGCAAAGGCCGGATTCCTACTTCA

ACAG - UNI9794 - GCATTTCCCCTCAGATGGAGGTCACATGTGTGCCCACCCCCACAAGCACAGTGTCCTCCCTAGGTAACACAAATGGAGAAGAA

GTGGGGCCATCTGTCTACTTGGAAAGGCTAAAAATTCTGCGGCAGCGGTGTGGTCTTGACAACACAAAG CAAGATGACCGGCCTCCACTGACCTCTTTG

CTCTCCAAACCAGCAATTCCTCCAGTTGCCTCCTCCACAGACATGCTCCATAGCAAGCTCTCACAGCTCCGGGAGTCCCGGGAACAGCACCAGCACTCAG

ACCTGGATTCCAACCAGACCCACTCTGCAGGAACCATGACCTCCTCCTCCTCCACAACTAACATTGATGACTTGAAAAAGAGACTGGAGAGAATAAAGAG

CAGTCGCAAATGAAGCTGCCCACCCTCGGCACTCTGCAGCTTTAGTTACTGATCTAGAAGCCCTGTAGTGTGAAGCGGCCGCTGCAGGCCATTGTACACA

AACTGGTTGTATGTATCAGACTGCAGATGGGAGGAGCAGTGGTGCCTCAAGTCTGCACATGCTCTGCTTCTAGAAGACTGACTGTGGATTAGCTTAGTGT

ACAGACTTTAAACAGCTGCTCCCTCAGCTCAGAGTAGGTTCCATATCCTTTTTTTTTGTTTTGTTTTAATGGCTCATTTGTAAAATTGTCCTAATTTTTC

CTAGCTTTCAGCCATTAGAAACTCTTTTAATAGTTCCTTTTGAGTTGTGAGCTCTTCTTCTGTAGCCCTGAAGGGACACTGTATTCTGTATGAATGCATG

GCATGAGACAACTAATTTAAGAGACTTTTATAAATAAAGTTTGCATTAACT
Translation
 - UNI10915 - - UNI30144 - MGDDSEWLKLPVDQKCEHK - UNI29035 - LWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTD

SNAVVQLKGLEAALVYVENAHVAGK - UNI26812 - KTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVAC

IETLRKALS SEFGSKIISLKPIIKVLPKLFESRDKAVRDEAKLFAIEIYRWNRDAVKHTLQNINSVQ LKELEEEWVKLPTGAPKPSRFLRSQQELEAK

LEQQQSAGGDAEGG - UNI14861 - GGDDGDEVPQVDAYELLDAVEILSKLPKDFYDKI EAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALK

K - UNI16070 - VVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAGH - UNI8026 - VVPTILEKFKEKKPQVVQALQEAIDAIFLT TTLQNI

SEDVLAVMDNKNPTIKQQTSLFIARSFRHCTSSTLPKSLLKPFCAALLK HINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDR - UNI4

356 - IKECSEKVELVHGKKSGLATEKKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAK - UNI5363 - AGGPSKKGKTTAPGGSASAG

TKNKKGLETKEIVEPELS IEVCEEKASAVLPPTCIQLLDSSNWKERLACMEEFQK AVELMERTEMPCQALVKMLAKKPGWKETNFQ - UNI1600 -

 VMQMKLHIVALIAQKGNFSKTSAQIVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQ - UNI29083 - VMSMAFSQKNPKNQSETLNWLSN

AIKEFGFSE ELNVKAFISNVKTALAATNP AVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQK MQGQSPPAPTRGIAKHSTSATDEGED

GEEPGEGGNDVVDLLPRIEIS SDKITSELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLNDSNKIL VQQTLNILQQLAVAMGAN

IRQHVKNLGIPVITVLGDSK NNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQE - UNI10990 - LLGWLAEKLPTLRSTPTDLILC

VPHLYSCLKDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLK - UNI5666 - PTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPI

PA - UNI15599 - APVEDSVSSTIEAKPDLKKAKAPGVSSKAK SVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLK VLKWNFTTPR

DEYIEQLKTQMSTCVAKWLQDEMFHSDFQHHNKALAVMVD HLESEKDGVISCLDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLSEEEYHLTENEAS

SFIPYLILK VGEPKDVIRKDVRAILNRMCLVYPASKMFPFIMEGTKSKNSKQRAE ECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNA

ALNTIVTVYNVHGDQVFKLIGN LSEKDMSMLEERIKRSAKRPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLN NQARSLSGHPEAAQMVRR

EFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPK KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQ LFQIESLAREASTGVL

KDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSDQTNILS - UNI1688 - SALLVLLQDSLLATASSPKFSELVMK CLWRMVRLLPDTI

NSINLDRILLDIHIFMKVFPKEKLKQCKSEFPIRTLKTLLHTLCKLKGPK ILDHLTMIDNKNESELEAHLCRMMKHSMDQTGSKSDKETEKGASRI DE

KSSKAKVNDFLAEIFKKIGSKENTKE GLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTG - UNI9794 - GISPQM

EVTCVPTPTSTVSSLGNTNGEEVGPSVYLERLKILRQRCGLDNTK QDDRPPLTSLLSKPAIPPVASSTDMLHSKLSQLRESREQHQHSDLDSNQTHSAG

TMTSSSSTTNIDDLKKRLERIKSSRK
Transcript ENSMUST00000111337
Sequence
AACTCCAAGAGAAAACTAGAAGCACAATGGGAGATGACAGTGAGTGGTTGAAATTACCAGTTGATCAGAAATGTGAACACAAG - UNI29035 - CTA

TGGAAAGCAAGATTAAGTGGGTATGAAGAAGCCTTGAAGATCTTCCAGAAAATAAAGGATGAAAAGAGTCCAGAATGGTCCAAATACTTAGGATTAATCA

AAAAATTTGTCACTGATTCCAATGCAGTGGTTCAATTGAAAGGACTAGAAGCTGCACTTGTCTATGTTGAAAATGCTCATGTTGCAGGAAA - UNI268

12 - AACAACGGGAGAGGTTGTATCAGGTGTTGTAAGTAAAGTCTTCAACCAACCTAAAGCCAAAGCCAAGGAACTGGGCATAGAGATTTGCCTCATGT

ATGTTGAGATTGAAAAAGGAGAGTCTGTACAAGAAGAGCTTCTGAAGGGCCTGGATAACAAGAACCCCAAGATCATAGTGGCCTGTATAGAAACACTGAG

GAAAGCCTTAAG TGAATTTGGTTCCAAAATCATCTCACTTAAGCCAATTATTAAAGTGTTGCCAAAACTATTTGAATCTCGAGACAAGGCTGTTCGGGA

TGAAGCCAAATTATTTGCTATAGAGATTTATCGATGGAATCGAGATGCTGTGAAACACACACTACAAAATATAAATTCTGTCCAG TTGAAAGAATTAGA

AGAAGAGTGGGTCAAGCTGCCAACAGGTGCTCCTAAGCCCAGTCGGTTTCTGCGTTCCCAACAAGAACTAGAAGCTAAACTGGAACAGCAACAGTCTGCT

GGTGGAGATGCAGAAGGGG - UNI14861 - GTGGTGATGATGGTGATGAGGTACCACAGGTAGATGCTTATGAGCTTCTGGATGCGGTAGAGATCCT

TTCCAAACTTCCCAAAGACTTTTATGACAAAATT GAGGCAAAGAAATGGCAAGAGAGAAAAGAAGCTCTGGAGGCTGTAGAAGTACTAGTGAAAAACCC

CAAGCTGGAAGCAGGCGATTACGCAGATTTAGTGAAAGCATTAAAAAAG - UNI16070 - GTTGTTGGAAAGGACACCAATGTCATGTTGGTAGCTT

TGGCAGCAAAATGTCTTACTGGCTTAGCTGTTGGGCTCAGAAAGAAATTTGGACAATATGCAGGACAT - UNI8026 - GTTGTGCCAACAATTTTGG

AAAAATTCAAAGAAAAGAAGCCTCAAGTGGTACAAGCCCTGCAGGAGGCAATTGATGCAATCTTCCTCACT ACCACACTACAGAACATCAGTGAGGATG

TCTTAGCAGTAATGGATAATAAAAATCCCACCATCAAGCAGCAGACATCACTTTTTATTGCAAGAAGCTTTCGTCACTGCACTTCCTCTACATTGCCGAA

GAGTCTACTAAAACCCTTTTGTGCTGCTCTACTTAAG CACATCAATGATTCTGCTCCTGAAGTCAGAGATGCTGCATTTGAAGCACTGGGTACAGCTTT

GAAGGTGGTTGGTGAGAAATCAGTAAACCCATTTTTAGCTGATGTTGACAAACTCAAACTTGATAGG - UNI4356 - ATCAAAGAATGTTCAGAAAA

AGTAGAACTGGTTCATGGTAAAAAATCTGGACTTGCAACTGAAAAGAAGGAATCCAAGCCTCTACCTGGAAGGGCTGCAGCATCAGGGGCTGCAGGGGAC

AAAGACACAAAAGATGTTTCAGGACCCAAACCAGGACCGTTAAAAAAAACACCTACTGCTAAG - UNI5363 - GCTGGTGGACCATCTAAGAAAGGT

AAAACAACTGCACCAGGTGGCTCAGCAAGTGCCGGGACAAAGAATAAGAAAGGATTGGAGACCAAAGAAATAGTGGAGCCAGAACTCTCA ATTGAAGTA

TGTGAAGAGAAAGCTTCAGCTGTTCTTCCCCCAACCTGTATTCAGCTTCTAGACAGCAGCAACTGGAAGGAAAGGCTGGCCTGTATGGAAGAATTCCAAA

AG GCTGTTGAACTAATGGAGCGAACTGAGATGCCGTGCCAGGCATTGGTGAAGATGCTAGCAAAAAAACCTGGATGGAAAGAAACTAATTTTCAG - U

NI1600 - GTGATGCAGATGAAGCTTCACATTGTTGCTTTGATTGCCCAGAAGGGAAATTTTTCTAAAACGTCTGCTCAGATTGTATTAGATGGCCTTG

TAGACAAGATTGGAGATGTGAAATGTGGGAACAATGCAAAAGAAGCCATGACAGCAATAGCTGAAGCGTGCATGCTGCCCTGGACAGCTGAGCAG - UN

I29083 - GTGATGTCAATGGCCTTCTCACAAAAGAATCCTAAGAATCAATCAGAAACTCTAAATTGGCTATCAAATGCAATAAAAGAATTTGGATTTT

CTGA GTTGAATGTCAAAGCTTTCATTAGCAACGTGAAGACTGCTCTTGCTGCAACAAATCCT GCTGTGAGGACTTCTGCCATCACCCTGCTTGGCGTG

ATGTATCTATATGTTGGTCCTTCTTTGAGAATGATCTTTGAGGATGAGAAGCCTGCCCTCCTATCCCAGATAGATGCAGAATTTCAAAAG ATGCAGGGA

CAAAGTCCTCCCGCTCCAACGAGGGGAATTGCTAAGCACAGCACAAGTGCTACAGATGAAGGAGAAGATGGAGAGGAACCAGGTGAAGGGGGCAATGATG

TTGTTGATCTTTTGCCGAGGATTGAGATCAG TGACAAAATTACTTCAGAGTTGGTGTCTAAGATTGGTGACAAGAATTGGAAGATCAGGAAAGAAGGCC

TAGATGAAGTGGCAGGTATTATCAATGAAGCAAAATTTATCCAACCAAATATAGGTGAACTTCCAACTGCCTTGAAGGGTCGACTGAATGATTCAAACAA

AATCTTG GTGCAGCAGACACTGAATATCCTTCAGCAACTGGCAGTAGCCATGGGTGCAAACATCAGGCAGCATGTAAAGAACCTGGGCATCCCTGTCAT

TACTGTTCTCGGAGATAGCAAG AACAATGTTCGAGCTGCTGCCCTAGCAACTGTGAATGCTTGGGCAGAACAAACTGGCATGAAAGAATGGCTGGAGGG

AGAAGATCTTTCTGAAGAACTTAAAAAGGAAAATCCCTTCCTGAGGCAAGAG - UNI10990 - CTTCTGGGATGGCTGGCAGAGAAACTACCTACAC

TCCGTTCCACTCCTACAGATCTTATCCTTTGTGTTCCTCATCTGTATTCCTGTCTAAAAGATCGAAATGGAGATGTACGGAAGAAGGCCCAAGATGCTTT

GCCATTCTTTATGATGCATTTAGGATATGAAAAAATGGCTAAGGCTACTGGGAAACTAAAG - UNI5666 - CCAACTTCTAAAGATCAAGTACTGGC

CATGCTAGAAAAGGCCAAAGCTAACATGCCATCCAAGCCTGCTGCACCTGCTAAGGCCATGTCCAAACCAATGGGAGGGTCGGCTCCAGCCAAAACCCAG

CCTATACCAG - UNI15599 - CACCTGTTGAAGATTCTGTTTCCAGTACCATAGAAGCTAAGCCTGATCTGAAAAAGGCTAAAGCTCCAGGCGTTTC

TTCCAAAGCAAAG AGTGTACAAGGGAAGAAAGTGCCAAGCAAAACCACCTTAAAGGAAGACGACGACAAATCTGGTCCTATTTTTATTGTTGTTCCAAA

TGGAAAGGAGCAAAGGATGAGAGATGAGAAAGGATTAAAG GTGCTAAAGTGGAATTTTACTACCCCACGGGATGAGTACATTGAACAGCTGAAGACTCA

GATGTCTACCTGTGTGGCTAAATGGTTACAGGATGAAATGTTTCACTCAGATTTCCAGCATCACAATAAAGCCCTAGCTGTCATGGTTGAT CACTTGGA

AAGTGAAAAAGACGGTGTCATCAGTTGCTTAGATCTTATCTTAAAATGGCTTACCCTCCGGTTTTTCGACACCAATACAAGCGTTCTAATGAAAGCACTG

GAATATTTAAAATTGCTTTTCACCCTGCTGAGTGAGGAAGAGTATCATCTTACTGAGAATGAAGCATCGTCCTTTATCCCCTATCTCATCCTCAAG GTT

GGAGAACCAAAGGATGTCATTCGTAAAGATGTCCGTGCTATCCTGAACCGGATGTGCCTTGTCTACCCAGCCAGCAAAATGTTCCCCTTCATTATGGAAG

GAACCAAGTCCAAAAACTCTAAGCAGAGAGCAG AGTGCCTGGAAGAGCTAGGTTGCTTAATTGAGTCCTATGGTATGAATGTTTGTCAGCCAACCCCAG

GAAAAGCCTTAAAGGAGATAGCTATTCACATAGGAGACCGAGACAATGCTGTACGGAATGCTGCCCTCAACACCATTGTAACAGTGTACAACGTGCATGG

AGATCAGGTGTTCAAACTGATTGGAAAT CTTTCTGAGAAAGACATGAGCATGCTTGAGGAGAGGATAAAGCGGTCAGCAAAGAGACCCTCTGCTGCACC

TGTGAAACAGGCCGAAGAGAAACCTCAGCGCACACAGAATATAAACTCTAATGCCAACATGCTACGCAAGGGACCAGCTGAGGATATGTCCTCCAAACTT

AA TCAAGCTCGAAGCCTGAGTGGGCATCCTGAAGCAGCCCAGATGGTTCGCCGAGAATTCCAGCTGGATTTAGATGAGATTGAAAATGATAATGGTACA

GTCCGCTGTGAAATGCCAGAGCTTGTCCAGCACAAACTTGATGACATTTTTGAACCTGTCCTTATTCCTGAACCTAA GATCCGGGCTGTTTCTCCACAT

TTTGATGACATGCACAGTAATACAGCATCCACAATCAATTTCATTATCTCCCAAGTAGCCAGTGGTGACATCAACACAAGCATCCAAGCTCTGACACAG 

CTATTTCAGATAGAGAGCTTGGCCCGGGAGGCCTCCACTGGAGTACTGAAAGACCTGATGCATGGACTGATCACCTTAATGCTGGATTCTCGGATTGAAG

ATCTGGAGGAAGGACAACAGGTGATTCGTTCTGTGAACCTCTTGGTGGTGAAGGTTTTGGAGAAATCAGACCAGACCAATATCCTCAG - UNI1688 -

 TGCCCTGCTTGTTTTACTTCAGGACAGCCTGCTAGCAACAGCTAGTTCTCCCAAATTCTCAGAGCTTGTTATGAAG TGTCTATGGAGAATGGTTCGAC

TATTACCTGACACCATCAACAGCATTAACCTAGACAGAATTCTTCTGGACATCCACATTTTCATGAAGGTCTTTCCCAAAGAGAAATTGAAGCAATGCAA

AAGTGAATTTCCTATAAGGACTCTAAAGACCCTTCTACATACTTTATGCAAATTAAAAGGACCTAAA ATCCTAGACCACCTTACAATGATTGATAATAA

GAATGAGTCAGAATTGGAGGCCCACCTGTGTCGGATGATGAAGCATAGTATGGACCAGACTGGGAGCAAGTCTGATAAGGAAACAGAAAAGGGAGCTTCT

CGAATA GATGAAAAATCATCAAAGGCCAAAGTAAATGATTTCTTAGCTGAGATTTTTAAGAAGATTGGCTCCAAAGAGAACACTAAGGAG GGCCTAGC

AGAGTTATATGAATATAAGAAGAAATATTCAGATACTGACATTGAACCATTTCTGAAAAATTCCTCGCAGTTCTTTCAGAGTTATGTTGAGAGAGGCCTT

CGGGTGATTGAGATGGAGAGAGAAAGCAAAGGCCGGATTCCTACTTCAACAG - UNI9794 - GCATTTCCCCTCAGATGGAGGTCACATGTGTGCCC

ACCCCCACAAGCACAGTGTCCTCCCTAGGTAACACAAATGGAGAAGAAGTGGGGCCATCTGTCTACTTGGAAAGGCTAAAAATTCTGCGGCAGCGGTGTG

GTCTTGACAACACAAAG CAAGATGACCGGCCTCCACTGACCTCTTTGCTCTCCAAACCAGCAATTCCTCCAGTTGCCTCCTCCACAGACATGCTCCATA

GCAAGCTCTCACAGCTCCGGGAGTCCCGGGAACAGCACCAGCACTCAGACCTGGATTCCAACCAGACCCACTCTGCAGGAACCATGACCTCCTCCTCCTC

CACAACTAACATTGATGACTTGAAAAAGAGACTGGAGAGAATAAAGAGCAGTCGCAAATGAAGCTGCCCACCCTCGGCACTCTGCAGCTTTAGTTACTGA

TCTAGAAGCCCTGTAGTGTGAAGCGGCCGCTGCAGGCCATTGTACACAAACTGGTTGTATGTATCAGACTGCAGATGGGAGGAGCAGTGGTGCCTCAAGT

CTGCACATGCTCTGCTTCTAGAAGACTGACTGTGGATTAGCTTAGTGTACAGACTTTAAACAGCTGCTCCCTCAGCTCAGAGTAGGTTCCATATCCTTTT

TTTTTGTTTTGTTTTAATGGCTCATTTGTAAAATTGTCCTAATTTTTCCTAGCTTTCAGCCATTAGAAACTCTTTTAATAGTTCCTTTTGAGTTGTGAGC

TCTTCTTCTGTAGCCCTGAAGGGACACTGTATTCTGTATGAATGCATGGCATGAGACAACTAATTTAAGAGACTTTTATAAATAAAGTTTGCATTAACTA

Translation
MGDDSEWLKLPVDQKCEHK - UNI29035 - LWKARLSGYEEALKIFQKIKDEKSPEWSKYLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGK -

 UNI26812 - KTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYVEIEKGESVQEELLKGLDNKNPKIIVACIETLRKALS SEFGSKIISLKPIIKVL

PKLFESRDKAVRDEAKLFAIEIYRWNRDAVKHTLQNINSVQ LKELEEEWVKLPTGAPKPSRFLRSQQELEAKLEQQQSAGGDAEGG - UNI14861 -

 GGDDGDEVPQVDAYELLDAVEILSKLPKDFYDKI EAKKWQERKEALEAVEVLVKNPKLEAGDYADLVKALKK - UNI16070 - VVGKDTNVMLVA

LAAKCLTGLAVGLRKKFGQYAGH - UNI8026 - VVPTILEKFKEKKPQVVQALQEAIDAIFLT TTLQNISEDVLAVMDNKNPTIKQQTSLFIARSF

RHCTSSTLPKSLLKPFCAALLK HINDSAPEVRDAAFEALGTALKVVGEKSVNPFLADVDKLKLDR - UNI4356 - IKECSEKVELVHGKKSGLATE

KKESKPLPGRAAASGAAGDKDTKDVSGPKPGPLKKTPTAK - UNI5363 - AGGPSKKGKTTAPGGSASAGTKNKKGLETKEIVEPELS IEVCEEKA

SAVLPPTCIQLLDSSNWKERLACMEEFQK AVELMERTEMPCQALVKMLAKKPGWKETNFQ - UNI1600 - VMQMKLHIVALIAQKGNFSKTSAQIV

LDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQ - UNI29083 - VMSMAFSQKNPKNQSETLNWLSNAIKEFGFSE ELNVKAFISNVKTALAA

TNP AVRTSAITLLGVMYLYVGPSLRMIFEDEKPALLSQIDAEFQK MQGQSPPAPTRGIAKHSTSATDEGEDGEEPGEGGNDVVDLLPRIEIS SDKIT

SELVSKIGDKNWKIRKEGLDEVAGIINEAKFIQPNIGELPTALKGRLNDSNKIL VQQTLNILQQLAVAMGANIRQHVKNLGIPVITVLGDSK NNVRAA

ALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQE - UNI10990 - LLGWLAEKLPTLRSTPTDLILCVPHLYSCLKDRNGDVRKKAQDALPFFM

MHLGYEKMAKATGKLK - UNI5666 - PTSKDQVLAMLEKAKANMPSKPAAPAKAMSKPMGGSAPAKTQPIPA - UNI15599 - APVEDSVSSTI

EAKPDLKKAKAPGVSSKAK SVQGKKVPSKTTLKEDDDKSGPIFIVVPNGKEQRMRDEKGLK VLKWNFTTPRDEYIEQLKTQMSTCVAKWLQDEMFHSD

FQHHNKALAVMVD HLESEKDGVISCLDLILKWLTLRFFDTNTSVLMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLILK VGEPKDVIRKDVRAILN

RMCLVYPASKMFPFIMEGTKSKNSKQRAE ECLEELGCLIESYGMNVCQPTPGKALKEIAIHIGDRDNAVRNAALNTIVTVYNVHGDQVFKLIGN LSEK

DMSMLEERIKRSAKRPSAAPVKQAEEKPQRTQNINSNANMLRKGPAEDMSSKLN NQARSLSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHK

LDDIFEPVLIPEPK KIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQALTQ LFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIR

SVNLLVVKVLEKSDQTNILS - UNI1688 - SALLVLLQDSLLATASSPKFSELVMK CLWRMVRLLPDTINSINLDRILLDIHIFMKVFPKEKLKQC

KSEFPIRTLKTLLHTLCKLKGPK ILDHLTMIDNKNESELEAHLCRMMKHSMDQTGSKSDKETEKGASRI DEKSSKAKVNDFLAEIFKKIGSKENTKE 

GLAELYEYKKKYSDTDIEPFLKNSSQFFQSYVERGLRVIEMERESKGRIPTSTG - UNI9794 - GISPQMEVTCVPTPTSTVSSLGNTNGEEVGPSV

YLERLKILRQRCGLDNTK QDDRPPLTSLLSKPAIPPVASSTDMLHSKLSQLRESREQHQHSDLDSNQTHSAGTMTSSSSTTNIDDLKKRLERIKSSRK

For any suggestions or comments, please send an email to unitrap@crg.es