Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040562 (Gstm2)
Chromosomal location
Chr 3: 107784623 - 107789371 (-)
Description
glutathione S-transferase, mu 2 Gene [Source:MGI (curated);Acc:Gstm2-001]
RefSeq_dna
NM_008183 
RefSeq_peptide
NP_032209.1 
UniGene
Mm.398346 
MGI
MGI:95861 
Uniprot/SWISSPROT
P15626 
Human Ortholog
not available
Omim not available
UniTrap UNI17937
Vector Insertion
Chr 3: 107787143 - 107787966
Public Clones not available
Private Clones OST433164 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29065
Vector Insertion
Chr 3: 107785057 - 107786853
Public Clones CMHD-GT_234C4-3 (cmhd) CMHD-GT_471H3-3 (cmhd) CMHD-GT_470H6-3 (cmhd) PSTVUpb13f8 (vanderbilt)
Private Clones OST9804 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13951
Vector Insertion
Chr 3: 107784864 - 107785057
Public Clones CMHD-GT_132D5-3 (cmhd) CMHD-GT_137H9-3 (cmhd) CMHD-GT_160C12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066530
Sequence
GGGGTGAGTGAGAACGCTTCTGCTGGGTGGGACAGGGGTGGGGTGGGGAGTAGCTAGGGAACTGATTTCCAGGAGATAGACTGAGTTCAGAAGTTGTTGG

AAGTTCAAACACGAGAGCTTGTGCTTATGTG CTGGCTCACGCCATCCGCCTGCTCCTGGAATACACAGACACAAGCTATGAGGACAAGAAATACACCAT

GGGGGACG CTCCTGACTATGACCGAAGCCAGTGGCTGAGTGAGAAGTTCAAGCTGGGCCTGGACTTTCCCAAT CTGCCCTACTTGATTGATGGATCAC

ACAAGATCACCCAGAGCAATGCCATCCTGCGCTACCTTGCCCGAAAGCACAACCTGT GTGGAGAGACAGAGGAGGAGAGGATTCGTGTGGACATTTTGG

AGAACCAGGCTATGGACACCCGCATACAGTTGGCCATGGTTTGCTACAGCCCTGACTTT - UNI17937 - GAGAAAAAGAAGCCAGAGTACTTAGAG

GGTCTCCCTGAGAAGATGAAGCTCTACTCTGAGTTTCTGGGCAAGCAGCCATGGTTTGCAGGGAACAAG GTCACCTATGTGGATTTTCTTGTTTATGAT

GTCCTTGATCAACACCGAATATTTGAGCCCAAGTGCCTGGATGCCTTCCCAAACCTGAAGGACTTCATGGGTCGCTTTGAG - UNI13951 - - UNI

29065 - GGCCTGAAGAAGATATCTGACTACATGAAGAGCAGCCGCTTCCTCTCCAAGCCAATCTTTGCAAAGATGGCCTTTTGGAACCCAAAGTAGGA

TTACAAAGCCCAGACCTGGGGGAATACTCATGAGTGCTCTGCTGGCCCTAGCTCTTACCACGTGCAGCTTTCTTCTCCTTTCCATTCCCTATTCCTCCAT

Translation
 MGDA APDYDRSQWLSEKFKLGLDFPN LPYLIDGSHKITQSNAILRYLARKHNLC CGETEEERIRVDILENQAMDTRIQLAMVCYSPDF - UNI17

937 - EKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNK VTYVDFLVYDVLDQHRIFEPKCLDAFPNLKDFMGRFE - UNI13951 - - UNI29065

 - GLKKISDYMKSSRFLSKPIFAKMAFWNPK
Transcript ENSMUST00000012348
Sequence
ACATTATCAGGAAGCTCAGACTAGCAAGGCCCGGGTTGGTCTGCTCTGGACACCAGCACTATGCCTATGACACTAGGTTACTGGGACATCCGTGGG CTG

GCTCACGCCATCCGCCTGCTCCTGGAATACACAGACACAAGCTATGAGGACAAGAAATACACCATGGGGGACG CTCCTGACTATGACCGAAGCCAGTGG

CTGAGTGAGAAGTTCAAGCTGGGCCTGGACTTTCCCAAT CTGCCCTACTTGATTGATGGATCACACAAGATCACCCAGAGCAATGCCATCCTGCGCTAC

CTTGCCCGAAAGCACAACCTGT GTGGAGAGACAGAGGAGGAGAGGATTCGTGTGGACATTTTGGAGAACCAGGCTATGGACACCCGCATACAGTTGGCC

ATGGTTTGCTACAGCCCTGACTTT - UNI17937 - GAGAAAAAGAAGCCAGAGTACTTAGAGGGTCTCCCTGAGAAGATGAAGCTCTACTCTGAGTT

TCTGGGCAAGCAGCCATGGTTTGCAGGGAACAAG GTCACCTATGTGGATTTTCTTGTTTATGATGTCCTTGATCAACACCGAATATTTGAGCCCAAGTG

CCTGGATGCCTTCCCAAACCTGAAGGACTTCATGGGTCGCTTTGAG - UNI13951 - - UNI29065 - GGCCTGAAGAAGATATCTGACTACATG

AAGAGCAGCCGCTTCCTCTCCAAGCCAATCTTTGCAAAGATGGCCTTTTGGAACCCAAAGTAGGATTACAAAGCCCAGACCTGGGGGAATACTCATGAGT

GCTCTGCTGGCCCTAGCTCTTACCACGTGCAGCTTTCTTCTCCTTTCCATTCCCTATTCCTCCATTTCCTCTTCCCAGCCCTTCCCTCAGCCAAGCCTCT

GGGTCCTTGGGCTCTCCATTTCTTCATTAGTCTCCTCCTATCCCTTGTCTCTGCCCTGCATCCAGCCCTTCCCTCAGTGATGGTTGGAGGAATGTACTAG

ACCCGAGAATCCCCGGCCTGGCCTGAGAGATTAGATCTGTCTGTGTGCTGCCTTGGTCCTCAGAGTAAGCAGCTAAGCCCCATTTGGTTCTCAATAAAGT

GTGAATC
Translation
MPMTLGYWDIRG LAHAIRLLLEYTDTSYEDKKYTMGDA APDYDRSQWLSEKFKLGLDFPN LPYLIDGSHKITQSNAILRYLARKHNLC CGETEEER

IRVDILENQAMDTRIQLAMVCYSPDF - UNI17937 - EKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNK VTYVDFLVYDVLDQHRIFEPKCLDAFP

NLKDFMGRFE - UNI13951 - - UNI29065 - GLKKISDYMKSSRFLSKPIFAKMAFWNPK

For any suggestions or comments, please send an email to unitrap@crg.es