Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040591 (1110051M20Rik)
Chromosomal location
Chr 2: 91117132 - 91284837 (-)
Description
RIKEN cDNA 1110051M20 gene Gene [Source:MGI Symbol;Acc:MGI:1915079]
RefSeq_dna
NM_175123 
RefSeq_peptide
NP_780332.1 
MGI
MGI:1915079 
Uniprot/SWISSPROT
Q8BHR8 
Uniprot/SPTREMBL
A2AII6 Q810Q1 
Human Ortholog
ENSG00000149179 (C11orf49)
Omim not available
UniTrap UNI17458
Vector Insertion
Chr 2: 91262126 - 91284725
Public Clones IST14714C4 (tigm) IST10051H12 (tigm) IST12255C12 (tigm) IST13725F6 (tigm)
Private Clones OST442416 (lexicon) OST433944 (lexicon) OST432699 (lexicon) OST420179 (lexicon)
OST418390 (lexicon) OST359724 (lexicon) OST358370 (lexicon) OST334351 (lexicon)
OST331304 (lexicon) OST162568 (lexicon) OST162567 (lexicon) OST116092 (lexicon)
OST78380 (lexicon) OST66936 (lexicon) OST66918 (lexicon) OST63969 (lexicon)
OST33982 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36878
Vector Insertion
Chr 2: 91224017 - 91262022
Public Clones (sanger) W009G12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35415
Vector Insertion
Chr 2: 91144905 - 91224017
Public Clones IST14864G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31924
Vector Insertion
Chr 2: 91119346 - 91122013
Public Clones IST14764B12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064652
Sequence
GGAGCGTGGAAACTACCCGGTCAAAGGATGCTGAGTCCCGAGCGCCTAGCTCTACCGGACTACGAGTATCTGG - UNI17458 - CTCAGAGACATGT

CCTCACGTACATGGAGGATGCAGTGTGCCAGCTGCTGGAGAACAGGGAGGATATTAGCCAGTATGGCATTGCCCGGTTCTTCACTGACTA - UNI3541

5 - - UNI36878 - TTTTAACAGCGTATGCCAAGGAACTCACATTCTCTTCCGGGAATTCAGCTTTATACAAGCCACACCTCATAATAGAGCATCAT

TCCTTCGGGCCTTCTGGAGATGCTTCCGAACTGTAGGGAAAAATGGTG - UNI35415 - ACCTGCTGACCATGAGGGAGTACCACTGTCTGCTGCAG

TTATTGTGCCCAGACTTCCCGCTGGAGCTTACTCAGAAAGCCGCCAG - UNI35415 - GATTGTGCTCATGGATGATGCCATGGACTGCCTGATGTC

TTTTTCAGATTTCCTTTTCGCCTTCCAGATCCAGTTTTATTACTCAG AATTCCTGGAGAGTGTGGCTGCCATCTATCAGGACTTGCTATCTGGGAAAAA

CCCCAATACAGTGATTGTCCCAACATCATCCAGTGGGCAACACCGCCAACGACCTGCCTTGGGTGATGCCGGTATGCTGGATGGAGTGGAAGCATCACTG

TTCTATCAGCGCCTGGAAAACCTGTGTGACCGGCACAAGTACAG - UNI31924 - CTGTCCACCACCAGCGCTTGTCAAAGAGATCCTGAGCAATGT

CCAGAGGCTGACTTTCTATGGATTCCTTGTGGCCCTCTCAAAGCATCATGGGATCAACCAAGCCCTGG - UNI31924 - GAGCTTTGCCAGACAAAG

GAGACCTGATGCACGACCCAGCCATGGATGAAGAGCTGGAACGGCT - UNI31924 - GGTGGTGAGGTCGAGGCTGTACCGGACCCCGCAGCAGCAA

AGGGGCAAGGAGCCAGGGGCCTTTGGCTTTGAAGGAAGAGACAAGCTGGAGGCCCCGGAGACAGTGCCCTCAGCTTTGGCACCAACGCCCAACCCATATC

GGTGGGAGCCCAGAGAGTGA
Translation
MLSPERLALPDYEYLA - UNI17458 - AQRHVLTYMEDAVCQLLENREDISQYGIARFFTDY - UNI35415 - - UNI36878 - YFNSVCQG

THILFREFSFIQATPHNRASFLRAFWRCFRTVGKNGD - UNI35415 - DLLTMREYHCLLQLLCPDFPLELTQKAAR - UNI35415 - RIVLMD

DAMDCLMSFSDFLFAFQIQFYYSE EFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFYQRLENLCDRHKYS - UNI319

24 - SCPPPALVKEILSNVQRLTFYGFLVALSKHHGINQALG - UNI31924 - GALPDKGDLMHDPAMDEELERL - UNI31924 - LVVRSRL

YRTPQQQRGKEPGAFGFEGRDKLEAPETVPSALAPTPNPYRWEPRE
Transcript ENSMUST00000111344
Sequence
AGACAGGCTGTAACCTGGGTTCCGGAAGAAGAAAGCTGGAGCGTGGAAACTACCCGGTCAAAGGATGCTGAGTCCCGAGCGCCTAGCTCTACCGGACTAC

GAGTATCTGG - UNI17458 - - UNI35415 - - UNI36878 - TTTTAACAGCGTATGCCAAGGAACTCACATTCTCTTCCGGGAATTCAGCT

TTATACAAGCCACACCTCATAATAGAGCATCATTCCTTCGGGCCTTCTGGAGATGCTTCCGAACTGTAGGGAAAAATGGTG - UNI35415 - ACCTG

CTGACCATGAGGGAGTACCACTGTCTGCTGCAGTTATTGTGCCCAGACTTCCCGCTGGAGCTTACTCAGAAAGCCGCCAG - UNI35415 - GATTGT

GCTCATGGATGATGCCATGGACTGCCTGATGTCTTTTTCAGATTTCCTTTTCGCCTTCCAGATCCAGTTTTATTACTCAG AATTCCTGGAGAGTGTGGC

TGCCATCTATCAGGACTTGCTATCTGGGAAAAACCCCAATACAGTGATTGTCCCAACATCATCCAGTGGGCAACACCGCCAACGACCTGCCTTGGGTGAT

GCCGGTATGCTGGATGGAGTGGAAGCATCACTGTTCTATCAGCGCCTGGAAAACCTGTGTGACCGGCACAAGTACAG - UNI31924 - CTGTCCACC

ACCAGCGCTTGTCAAAGAGATCCTGAGCAATGTCCAGAGGCTGACTTTCTATGGATTCCTTGTGGCCCTCTCAAAGCATCATGGGATCAACCAAGCCCTG

G - UNI31924 - GAGCTTTGCCAGACAAAGGAGACCTGATGCACGACCCAGCCATGGATGAAGAGCTGGAACGGCT - UNI31924 - GCTGGTC

CAGGTCCCAGGCCTGGTCAACTCCATCACTGCCACTTCTGAGGCCAGCTGCCTGCCTTCCCGAACCCCTCCCCGGGTTGGTTCCCCGTGGAAACCCCTCC

ATCGCTCCCGCAAATTGGATGCAGAGAGCGATGGCTCCACTGAAGAGACAGATGAGTCTGAGACTTGAATCTGAAGGGTCCCATCTGTGGCCTGTACCTT

GTTCCCACCCTGCTTTTGCTGCCCACACCAGACTTCTCCAGCATCACTGTGCCACCCTCTGCTGAAGAGAAGGGTGAATTAATAACAGCCCTAGTAAGAC

CAGCCCAGTTCAGTGATCCTCAGAATCCCCTAACTCATGCTCTCAGCAACCTGCTGGGCCCTGAGCTGACATACATCACAGAGAAGGGTCTGCTTTAGTC

TTCTGTTGGCAGGGCTGCTTATGCTTTAAGTACTGTCATCTCAGCCAGTCCATGATCCTCCTAGTAAGGGTAATTTTTCACAACAGCATTTATAAGGGAA

ACGTGAATTAGTAATGCAGGGTCTTCCTGGTGGAGGGTGATTCCTGAGAGCATGTGCTGGGAAGACCTATCAACTGGCCTGCTGGAGAGATCAGCCACTA

GCTGGAATAAGAGGGAGGATGGGCAAGAATTTTACTTTCAAAATATACTTCAAGTTTGTATGGAATAGTCAAATCTGTGAAATGAATAAAGTCCCTTGTG

TCTGGT
Translation
RQAVTWVPEEESWSVETTRSKDAESRAPSSTGLRVSG - UNI17458 - - UNI35415 - - UNI36878 - GFNSVCQGTHILFREFSFIQATP

HNRASFLRAFWRCFRTVGKNGD - UNI35415 - DLLTMREYHCLLQLLCPDFPLELTQKAAR - UNI35415 - RIVLMDDAMDCLMSFSDFLFA

FQIQFYYSE EFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFYQRLENLCDRHKYS - UNI31924 - SCPPPALVKE

ILSNVQRLTFYGFLVALSKHHGINQALG - UNI31924 - GALPDKGDLMHDPAMDEELERL - UNI31924 - LLVQVPGLVNSITATSEASCLP

SRTPPRVGSPWKPLHRSRKLDAESDGSTEETDESET
Transcript ENSMUST00000102594
Sequence
GGAGCGTGGAAACTACCCGGTCAAAGGATGCTGAGTCCCGAGCGCCTAGCTCTACCGGACTACGAGTATCTGG - UNI17458 - CTCAGAGACATGT

CCTCACGTACATGGAGGATGCAGTGTGCCAGCTGCTGGAGAACAGGGAGGATATTAGCCAGTATGGCATTGCCCGGTTCTTCACTGACTA - UNI3541

5 - - UNI36878 - TTTTAACAGCGTATGCCAAGGAACTCACATTCTCTTCCGGGAATTCAGCTTTATACAAGCCACACCTCATAATAGAGCATCAT

TCCTTCGGGCCTTCTGGAGATGCTTCCGAACTGTAGGGAAAAATGGTG - UNI35415 - ACCTGCTGACCATGAGGGAGTACCACTGTCTGCTGCAG

TTATTGTGCCCAGACTTCCCGCTGGAGCTTACTCAGAAAGCCGCCAG - UNI35415 - GATTGTGCTCATGGATGATGCCATGGACTGCCTGATGTC

TTTTTCAGATTTCCTTTTCGCCTTCCAGATCCAGTTTTATTACTCAG AATTCCTGGAGAGTGTGGCTGCCATCTATCAGGACTTGCTATCTGGGAAAAA

CCCCAATACAGTGATTGTCCCAACATCATCCAGTGGGCAACACCGCCAACGACCTGCCTTGGGTGATGCCGGTATGCTGGATGGAGTGGAAGCATCACTG

TTCTATCAGCGCCTGGAAAACCTGTGTGACCGGCACAAGTACAG - UNI31924 - CTGTCCACCACCAGCGCTTGTCAAAGAGATCCTGAGCAATGT

CCAGAGGCTGACTTTCTATGGATTCCTTGTGGCCCTCTCAAAGCATCATGGGATCAACCAAGCCCTGG - UNI31924 - GAGCTTTGCCAGACAAAG

GAGACCTGATGCACGACCCAGCCATGGATGAAGAGCTGGAACGGCT - UNI31924 - GCTGGTCCAGGTCCCAGGCCTGGTCAACTCCATCACTGCC

ACTTCTGAGGCCAGCTGCCTGCCTTCCCGAACCCCTCCCCGGGTTGGTTCCCCGTGGAAACCCCTCCATCGCTCCCGCAAATTGGATGCAGAGAGCGATG

GCTCCACTGAAGAGACAGATGAGTCTGAGACTTGAATCTGAAGGGTCCCATCTGTGGCCTGTACCTTGTTCCCACCCTGCTTTTGCTGCCCACACCAGAC

TTCTCCAGCATCACTGTGCCACCCTCTGCTGAAGAGAAGGGTGAATTAATAACAGCCCTAGTAAGACCAGCCCAGTTCAGTGATCCTCAGAATCCCCTAA

CTCATGCTCTCAGCAACCTGCTGGGCCCTGAGCTGACATACATCACAGAGAAGGGTCTGCTTTAGTCTTCTGTTGGCAGGGCTGCTTATGCTTTAAGTAC

TGTCATCTCAGCCAGTCCATGATCCTCCTAGTAAGGGTAATTTTTCACAACAGCATTTATAAGGGAAACGTGAATTAGTAATGCAGGGTCTTCCTGGTGG

AGGGTGATTCCTGAGAGCATGTGCTGGGAAGACCTATCAACTGGCCTGCTGGAGAGATCAGCCACTAGCTGGAATAAGAGGGAGGATGGGCAAGAATTTT

ACTTTCAAAATATACTTCAAGTTTGTATGGAATAGTCAAATCTGTGAAATGAATAAAGTCCCTTGTGTCTGGT
Translation
MLSPERLALPDYEYLA - UNI17458 - AQRHVLTYMEDAVCQLLENREDISQYGIARFFTDY - UNI35415 - - UNI36878 - YFNSVCQG

THILFREFSFIQATPHNRASFLRAFWRCFRTVGKNGD - UNI35415 - DLLTMREYHCLLQLLCPDFPLELTQKAAR - UNI35415 - RIVLMD

DAMDCLMSFSDFLFAFQIQFYYSE EFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFYQRLENLCDRHKYS - UNI319

24 - SCPPPALVKEILSNVQRLTFYGFLVALSKHHGINQALG - UNI31924 - GALPDKGDLMHDPAMDEELERL - UNI31924 - LLVQVPG

LVNSITATSEASCLPSRTPPRVGSPWKPLHRSRKLDAESDGSTEETDESET
Transcript ENSMUST00000094835
Sequence
AGAGACAGGCTGTAACCTGGGTTCCGGAAGAAGAAAGCTGGAGCGTGGAAACTACCCGGTCAAAGGATGCTGAGTCCCGAGCGCCTAGCTCTACCGGACT

ACGAGTATCTGG - UNI17458 - - UNI35415 - - UNI36878 - TTTTAACAGCGTATGCCAAGGAACTCACATTCTCTTCCGGGAATTCAG

CTTTATACAAGCCACACCTCATAATAGAGCATCATTCCTTCGGGCCTTCTGGAGATGCTTCCGAACTGTAGGGAAAAATGGTG - UNI35415 - ACC

TGCTGACCATGAGGGAGTACCACTGTCTGCTGCAGTTATTGTGCCCAGACTTCCCGCTGGAGCTTACTCAGAAAGCCGCCAG - UNI35415 - GATT

GTGCTCATGGATGATGCCATGGACTGCCTGATGTCTTTTTCAGATTTCCTTTTCGCCTTCCAGATCCAGTTTTATTACTCAG AATTCCTGGAGAGTGTG

GCTGCCATCTATCAGGACTTGCTATCTGGGAAAAACCCCAATACAGTGATTGTCCCAACATCATCCAGTGGGCAACACCGCCAACGACCTGCCTTGGGTG

ATGCCGGTATGCTGGATGGAGTGGAAGCATCACTGTTCTATCAGCGCCTGGAAAACCTGTGTGACCGGCACAAGTACAG - UNI31924 - CTGTCCA

CCACCAGCGCTTGTCAAAGAGATCCTGAGCAATGTCCAGAGGCTGACTTTCTATGGATTCCTTGTGGCCCTCTCAAAGCATCATGGGATCAACCAAGCCC

TGG - UNI31924 - GAGCTTTGCCAGACAAAGGAGACCTGATGCACGACCCAGCCATGGATGAAGAGCTGGAACGGCT - UNI31924 - GCTGG

TCCAGGTCCCAGGCCTGGTCAACTCCATCACTGCCACTTCTGAGGCCAGCTGCCTGCCTTCCCGAACCCCTCCCCGGGTTGGTTCCCCGTGGAAACCCCT

CCATCGCTCCCGCAAATTGGATGCAGAGAGCGATGGCTCCACTGAAGAGACAGATGAGTCTGAGACTTGAATCTGAAGGGTCCCATCTGTGGCCTGTACC

TTGTTCCCACCCTGCTTTTGCTGCCCACACCAGACTTCTCCAGCATCACTGTGCCACCCTCTGCTGAAGAGAAGGGTGAATTAATAACAGCCCTAGTAAG

ACCAGCCCAGTTCAGTGATCCTCAGAATCCCCTAACTCATGCTCTCAGCAACCTGCTGGGCCCTGAGCTGACATACATCACAGAGAAGGGTCTGCTTTAG

TCTTCTGTTGGCAGGGCTGCTTATGCTTTAAGTACTGTCATCTCAGCCAGTCCATGATCCTCCTAGTAAGGGTAATTTTTCACAACAGCATTTATAAGGG

AAACGTGAATTAGTAATGCAGGGTCTTCCTGGTGGAGGGTGATTCCTGAGAGCATGTGCTGGGAAGACCTATCAACTGGCCTGCTGGAGAGATCAGCCAC

TAGCTGGAATAAGAGGGAGGATGGGCAAGAATTTTACTTTCAAAATATACTTCAAGTTTGTATGGAATAGTCAAATCTGTGAAATGAATAAAGTCCCTTG

TGTCTGGTA
Translation
 - UNI17458 - - UNI35415 - - UNI36878 -  - UNI35415 - MREYHCLLQLLCPDFPLELTQKAAR - UNI35415 - RIVLMDD

AMDCLMSFSDFLFAFQIQFYYSE EFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPALGDAGMLDGVEASLFYQRLENLCDRHKYS - UNI3192

4 - SCPPPALVKEILSNVQRLTFYGFLVALSKHHGINQALG - UNI31924 - GALPDKGDLMHDPAMDEELERL - UNI31924 - LLVQVPGL

VNSITATSEASCLPSRTPPRVGSPWKPLHRSRKLDAESDGSTEETDESET

For any suggestions or comments, please send an email to unitrap@crg.es