Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040594 (Ranbp17)
Chromosomal location
Chr 11: 33112422 - 33413635 (-)
Description
RAN binding protein 17 Gene [Source:MGI (curated);Acc:Ranbp17-001]
RefSeq_dna
NM_023146 
RefSeq_peptide
NP_075635.1 
UniGene
Mm.440985 
MGI
MGI:1929706 
Uniprot/SWISSPROT
Q99NF8 
Uniprot/SPTREMBL
Q3TQ31 Q5SSA5 Q5SSA8 Q5SQB1 Q8BWS4 
Human Ortholog
ENSG00000204764 (RANBP17)
Omim not available
UniTrap UNI14321
Vector Insertion
Chr 11: 33404681 - 33413631
Public Clones E048E08 (ggtc) E123D10 (ggtc) D174D10 (ggtc) FHCRC-GT-S8-3B2 (fhcrc) FHCRC-GT-S19-5G1 (fhcrc)
IST10055B11 (tigm) IST12589F6 (tigm)
Private Clones OST322994 (lexicon) OST274262 (lexicon) OST271113 (lexicon) OST240195 (lexicon)
OST233367 (lexicon) OST210554 (lexicon) OST184060 (lexicon) OST174588 (lexicon)
OST172754 (lexicon) OST149960 (lexicon) OST124527 (lexicon) OST81059 (lexicon)
OST65600 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25861
Vector Insertion
Chr 11: 33400771 - 33404681
Public Clones not available
Private Clones OST157146 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1186
Vector Insertion
Chr 11: 33387748 - 33391326
Public Clones AY0041 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18277
Vector Insertion
Chr 11: 33386084 - 33387642
Public Clones not available
Private Clones OST426570 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30164
Vector Insertion
Chr 11: 33381021 - 33383080
Public Clones D095G07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4065
Vector Insertion
Chr 11: 33379290 - 33381021
Public Clones AP0912 (sanger)
Private Clones OST420375 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI217
Vector Insertion
Chr 11: 33372415 - 33375081
Public Clones GC0648 (tigem) YTC230 (baygenomics) A070B05 (ggtc) A041B06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2713
Vector Insertion
Chr 11: 33229545 - 33341802
Public Clones AE0656 (sanger) AL0109 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15956
Vector Insertion
Chr 11: 33228525 - 33229470
Public Clones not available
Private Clones OST469318 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9281
Vector Insertion
Chr 11: 33202871 - 33218238
Public Clones XG765 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12727
Vector Insertion
Chr 11: 33183991 - 33189563
Public Clones W015H01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11792
Vector Insertion
Chr 11: 33166325 - 33183907
Public Clones A034B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11366
Vector Insertion
Chr 11: 33143277 - 33164635
Public Clones A034A02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2160
Vector Insertion
Chr 11: 33119270 - 33143109
Public Clones XT0564 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037522
Sequence
GCTCCGGGAAGATGGCGCTGCACTTTCAG - UNI14321 - AGTTTGGCTGAGTTGGAAGTGCTGTGTACTCATCTCTACGTAGGGACCGATCTCACT

GAAAGAATAGAGGCTGAGAAAGCACTCTTGGAACTGATTGACAGCCCAGAATGTCTCAGCAAGTGTCAACTTTTACTAGAACAAGGAACA - UNI1432

1 - - UNI25861 - ACATCCTATGCTCAGCTCCTTGCAGCAACATGTCTTTCAAAACTTGTTACCCGAATCAATCCTTTACCTATTGAACAGAGGAT

AGACATCA GAAACTACATCCTGAATTATGTGGCGTCCCAACCTAAGCTGGCGCCCTTTGTCATCCAAGCTCTGATTCAAGTCATCGCTAAACTCACCAA

GTTGGGGTGGTTTGAGGTGCAGAAGGATGAGTTTGTTTTCCGAGAAATCATTGCTGATGTGAAGAAGTTCCTCCAG GGCACGGTGGAACACTGCATAAT

AGGAGTGATAATCCTTTGTGAATTGACACAGGAAATGAACTTG - UNI1186 - GTTGATTATTCCAGACCTTCAGCAAAACATAGGAAAATAGCTAC

CTCATTCCGTGACACTTCTCTAAAAGACATTCTGGTGTTAGCGTGTTCTCTCCTGAAACAG - UNI18277 - GTGTTGGCCAAACCTTTAAATCTTC

AGGATCAAGATCAACAGAGTCTGGTAATGCAGGTCTTAAAGCTGGTCCTCAGCTGCCTGAACTTTGACTTCCTGGGCAGTTCAGCAGACGAATCTGCGGA

CGATCTTTGCACAGTGCAGATTCCAACAACCTGGAGAACAA - UNI30164 - TTTTCCTAGAGCCAGAAACATTGGATCTTTTCTTCAATTTGTATC

ACTCGCTCCCACCACTGCTGTCTCAGTTA - UNI30164 - GCACTTTCGTGCTTAGTTCAGTTTGCTTCTACAAGAAGATCCTTATTTAGCAGTCCT

GAGCGCGCCAAGTACCTTGGTAACTTAATTAAAGGGGTGAAAAGGATACTTGAAAACCCCCAG - UNI4065 - - UNI30164 - GGTTTGTCTGA

TCCTGGCAATTATCATGAATTCTGTCGATTTTTGGCTCGTTTAAAGACAAACTATCAGCTGGGAGAGTTAGTTTTGGTGAAGGAGTATGCGGAAGTGATT

GGATTAATTGCCAATTTTACTATTACTAGCCTTCAG CATTGGGAGTTTGCCCCCAACAGTGTTCATTACTTATTAACTCTGTGGCAGAGGATGGTAGCA

TCCGTTCCTTTTGTGAAGTCAGCTGAACCCCACTTGTTAGACACTTATGCACCTGAAATCACAAAGGCCTTTATCACGTCCCGTTTGGAATCTGTTGCCA

TTGTTGTGAG - UNI217 - AGATAATTTAGAAGACCCTCTGGATGACACTGCTACCGTGTTCCAGCAGCTGGAGCAGCTGTGTACAGTTAGCAGATG

TGAATATGAAAAGACGTGTACTCTTCTTGTACAGCTATTTGACCAAAATGCACAGAACTATCAAAAGCTTCTGCATGCTGCTCCGGGGCTGGCTGTTGAC

ATGGCGATTCAAGAAGGTCAGTCTGTGTTAGACAGTTGTGAGCAGCGTGCCATAGGGAATCATTGTCAGAGTCCTTCGGTAAGCCAGGTGTGGTGGTGAC

ACCTTTAATCCCAGCACTCTGGAGCAGAGGCAGGTGGATCTCTGAGTTTGAGGCCAGTCTGTCTTGAGGTAAACTACTTTTATGTTTCTCTCATTGTTGT

CTAGTCCATTTTTAAACCACTAATCATATTAAGCCATTTGATATTTTGGTGACTTGACTATTGACCTTTAATATTTTTATGGGACACACAGGCAACAACT

CATCATGGACTCATCAGGAACAGTTGTTTAATGATCCTCAAGCAGGCAGTGTGATGTCATTGTCTTTGAAGTAATATTTTCTCCTTTTTTTAATAGTAGA

CTGAACACTTGGCTAAAGTCAGCCTGTAAAAGAAGCCTAACCAGATTTTATTTGTATTTATTCATTAGTCTTCACCATGGCTTTTAAATTATTTATTTAT

TTATTTATATTTATTTATTTATTTATTATTATTATTATTATTTTTTTTTTTGAGACAAGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGT

AGACCAGCCGTGGCTGGCCTTGAACTCAGAAAACCTCCTGCCTCTGCCTCCTAAGTGCTGGGATCAAAGGTGTGTGCCAGCCTTGCCTGGCCCGGCTTTT

AAATTTTGATCTTTATTATTTCATCTTTAATCTTACTGAGGGAGGGTGCACTTTTACATTCCTTTAAATACCTTCAGATAGTTAGCAGGGAATAATTATT

TTCAGATTTTTAAAATGCAATATAAGGATGAAATCATTTATAGCTTTTATTATTTGTTAGGTTAATATACAAAACAATGGGCTTCCCTGGCATAGCCACA

GGTCTGTGTTGCTCTGCTCTGCTCTCGTTCATTCCCATCCCTCTTCCCCACGGTCCTCGCTCCTGTGCGCCTCCTCGCTCCCTTCTTCACTCCCGTGTGT

CACTCCTGCTTCTGTGTCTCATACCTTCCACTCCTTTTCCTCCTTCCTTACCGTTTATGACCCTGTGTCATATGTTTTATGCCATGTACAACACCCACAG

ATAAAATATGCCCTATACTCATATGTTATACATACAATTTTAAATCTACAGTCTGTGTACAGGACAAAACAAGCAATGTATGTCTTTTGGAGTCTTTTAA

AATGATTTCTGGTTCTGTCCCTTTCTACCAAATGTTGTGATTTAATTTTTCATCATGGCTGGGTATGTGGGCACTCTTTTCTTATGTTTGTCGATGATCA

TGTAGGCTGGTGGCATTTCCAAGCCATGGCAACAGGCACAGCACTAGATAGGGAAGCACCGGTGCCTCTGTGGCCCCTGAGGAGAGATCCAGGACTGCTG

AATTCCGGCCGTAGCCCATTTCTGTACGGGCTGCACAGGGTTACATCCGCAACAGCTGCAAATGCCTGCCCTTTCCCGTTCATGTTGTCCTTTGTTGTCT

CATCCTAGTCATTGTCAAACTGGTCAAGGACTTCTTCTCAGAGCAACTTTACCTTTCTCTGATTGCAAGGATGCTGCGCTTCCTCATGTGTTTCCTGGCC

ATTTGTGCTTTTCCTTGTGACAGTTGTGTGGCAACTGCCCATGTTCATCTGCCCATGGCAGAACTGATTGGCGAGATAATAATTTTTTTTTTTTTTTTAC

TGTTTGTGTAGCTCTTTTTGTATTCTAGAAATATGAATGACCTTAAGACATATCATATGAAAATGCATGAAATTAAAAGGCTTATGCAGGCATCTGGAAT

AGTCAGCAGAGTGAGGGAAAGTCTACACAGGAAAGTATTTGAAAAAACCCCACCAGTTGAACAAAGCAACTAATTAAGTAAAGTAATTAGCCTGAGGTTA

AACACTTCGTTACCATCCCAGGGCTCTTTTTGCTACATAAGTACCTGACACCCTAGCCATTCATGGTCTTCTTTGCTTCCATATGATCTTTAGGATTCTT

TTCTAGTTGTTTGAATACTTACTATCTCTGAAATTTTGGTTGGGGTTACCGTGTTTCTGTAAGTCACTTTAGTGATGAAGCTGTTTTCATAAAACTAGTG

GTGGCAACTCATGAGCATAGGAAGTCCTCATCCGCAGCCCCTGGGGTCACCAGCTTCTCCTTCCCGTGGTCTGTAGAGCATAAGGAGTCCTCATCCGCTG

GTGTCGCCGGCTTCTCCTTCTCGTGGTTTGTAAAGTATTTACTGTAGTTGTGTTTGCCCTCCTCAGTTAAGGTTGTTATTGGGTTTTACTTATTTAAAGT

TATTATGAATGGGATTTTTAACCTCCTGATTTTTCCCTTTAGCAAGTGCATCATTTTGTTAAAAAAAAAAAAGCTTCTGAGTATTGGATGTTGGTTTGTG

TTCTGCATCTTGTTGAAAGGCTTTATCAAGTCTGAGTAGTCCTCAGGCACTATTAAAGATTTTACCATCTGTAAATAAGAATATTTG
Translation
MALHFQ - UNI14321 - SLAELEVLCTHLYVGTDLTERIEAEKALLELIDSPECLSKCQLLLEQGT - UNI14321 - - UNI25861 - TSYA

QLLAATCLSKLVTRINPLPIEQRIDIR RNYILNYVASQPKLAPFVIQALIQVIAKLTKLGWFEVQKDEFVFREIIADVKKFLQ GTVEHCIIGVIILCE

LTQEMNL - UNI1186 - VDYSRPSAKHRKIATSFRDTSLKDILVLACSLLKQ - UNI18277 - VLAKPLNLQDQDQQSLVMQVLKLVLSCLNFD

FLGSSADESADDLCTVQIPTTWRTI - UNI30164 - IFLEPETLDLFFNLYHSLPPLLSQL - UNI30164 - ALSCLVQFASTRRSLFSSPERA

KYLGNLIKGVKRILENPQ - UNI4065 - - UNI30164 - GLSDPGNYHEFCRFLARLKTNYQLGELVLVKEYAEVIGLIANFTITSLQ HWEFAP

NSVHYLLTLWQRMVASVPFVKSAEPHLLDTYAPEITKAFITSRLESVAIVVR - UNI217 - RDNLEDPLDDTATVFQQLEQLCTVSRCEYEKTCTLL

VQLFDQNAQNYQKLLHAAPGLAVDMAIQEGQSVLDSCEQRAIGNHCQSPSVSQVWW
Transcript ENSMUST00000102815
Sequence
GCGCCGCTCCGGGAAGATGGCGCTGCACTTTCAG - UNI14321 - AGTTTGGCTGAGTTGGAAGTGCTGTGTACTCATCTCTACGTAGGGACCGATC

TCACTGAAAGAATAGAGGCTGAGAAAGCACTCTTGGAACTGATTGACAGCCCAGAATGTCTCAGCAAGTGTCAACTTTTACTAGAACAAGGAACA - UN

I14321 - - UNI25861 - ACATCCTATGCTCAGCTCCTTGCAGCAACATGTCTTTCAAAACTTGTTACCCGAATCAATCCTTTACCTATTGAACAG

AGGATAGACATCA GAAACTACATCCTGAATTATGTGGCGTCCCAACCTAAGCTGGCGCCCTTTGTCATCCAAGCTCTGATTCAAGTCATCGCTAAACTC

ACCAAGTTGGGGTGGTTTGAGGTGCAGAAGGATGAGTTTGTTTTCCGAGAAATCATTGCTGATGTGAAGAAGTTCCTCCAG GGCACGGTGGAACACTGC

ATAATAGGAGTGATAATCCTTTGTGAATTGACACAGGAAATGAACTTG - UNI1186 - GTTGATTATTCCAGACCTTCAGCAAAACATAGGAAAATA

GCTACCTCATTCCGTGACACTTCTCTAAAAGACATTCTGGTGTTAGCGTGTTCTCTCCTGAAACAG - UNI18277 - GTGTTGGCCAAACCTTTAAA

TCTTCAGGATCAAGATCAACAGAGTCTGGTAATGCAGGTCTTAAAGCTGGTCCTCAGCTGCCTGAACTTTGACTTCCTGGGCAGTTCAGCAGACGAATCT

GCGGACGATCTTTGCACAGTGCAGATTCCAACAACCTGGAGAACAA - UNI30164 - TTTTCCTAGAGCCAGAAACATTGGATCTTTTCTTCAATTT

GTATCACTCGCTCCCACCACTGCTGTCTCAGTTA - UNI30164 - GCACTTTCGTGCTTAGTTCAGTTTGCTTCTACAAGAAGATCCTTATTTAGCA

GTCCTGAGCGCGCCAAGTACCTTGGTAACTTAATTAAAGGGGTGAAAAGGATACTTGAAAACCCCCAG - UNI4065 - - UNI30164 - GGTTTG

TCTGATCCTGGCAATTATCATGAATTCTGTCGATTTTTGGCTCGTTTAAAGACAAACTATCAGCTGGGAGAGTTAGTTTTGGTGAAGGAGTATGCGGAAG

TGATTGGATTAATTGCCAATTTTACTATTACTAGCCTTCAG CATTGGGAGTTTGCCCCCAACAGTGTTCATTACTTATTAACTCTGTGGCAGAGGATGG

TAGCATCCGTTCCTTTTGTGAAGTCAGCTGAACCCCACTTGTTAGACACTTATGCACCTGAAATCACAAAGGCCTTTATCACGTCCCGTTTGGAATCTGT

TGCCATTGTTGTGAG - UNI217 - AGATAATTTAGAAGACCCTCTGGATGACACTGCTACCGTGTTCCAGCAGCTGGAGCAGCTGTGTACAGTTAGC

AGATGTGAATATGAAAAGACGTGTACTCTTCTTGTACAGCTATTTGACCAAAATGCACAGAACTATCAAAAGCTTCTGCATGCTGCTCCGGGGCTGGCTG

TTGACATGGCGATTCAAGAAG - UNI217 - GACGTCTTGCATGGCTGATCTACTTGGTTGGCACAGTTGTAGGAGGGAGACTAACATATACCAGCAC

AGATGAGCATGATGCTATGGATGGAGAACTATCCTGCCG TGTTTTTCAGCTTATATCTTTAATGGATACCAGATTACCTCACTGCACCAATGAGAAAAT

AGAGCTTGCAGTTCTCTGGTTCCTGGATCAGTTTCGTAAAACATATGTTGGTGATCAGCTTCAAAGAACCTCAAAG - UNI2713 - GTGTATGCTCG

TATGTCAGAAGTCTTAGGAATAACAGATGATAACCATGTTCTGGAAACATTCATGACGAAAAT - UNI15956 - TGTTACAAACCTGAAGTACTGGG

GAAGATGTGAGCCTGTAATCTCCAGGACGCTTCAGTTCCTCAGTGACCTGTCAGTTGG CTATATCCTTTTAAAAAAACTTGTGAAAATAGATGCTGTGA

AATTCATGCTGAAAAATCACACG AGTGAACACTTCCCGTTTCTTGGCATCAGTGAAACTTACAATGTGGGTGACTTCAGGTGCCGGACAACCTTCTACA

CAGCCCTCACTCGCCTTCTGATGGTAGACCTGG - UNI9281 - GTGAAGATGAGGATGAATTTGAGAATTTTATGCTGCCTCTCACAGTCTCTTTTG

AAACAGTGTTACAAATATTCAACAATAACTTTAAACAGGAAGAAGTAAAG CGTATGTTGATCGGGCTGGCAAGAGATCTTCGAGGGATTGCCTTTGCAC

TGAACACAAAGACCAGCTACACCATGCTGTTTGACTGGAT ATACCCAGCCTATCTCCCAGTTCTTCAGAGAGCTATTGAACGGTGGTATGGAGAACCCG

CATGTACTACTCCAATCTTAAAACTCTTGGCAGAACTGATGCAAAACAG - UNI12727 - GTCTCAGCGTTTGAATTTTGATGTATCCTCTCCTAAT

GGAATTCTTCTCTTCAGAGAAGCCAGCAAAATGATTTGCACCTACG - UNI11792 - GAAATCAGATCCTGTCTCTTGGAAGTCTCTCCAAAGATAA

GATTTATCCAATGAAACTCAAGGGCATCTCCATCTGCTACTCAGCTCTCAAGTCTGCATTGTGTGGAAATTATGTCAGCTTTGGCGTCTTCAAGTTGTAT

GGGGACAACCATTTTGACAATGTACTCCAGGCCTTTGTCAAAATGCTGCTTTCAGTGTCTCACAGTGACTTGCTG CAATACCGGAAGCTGAGCCAGTCT

TACTATCCACTGCTGGAATGTCTCACCCAGGACCACATGAGCTTCATCACCAACTTGGAGCCTCCTGTGCTCCTGTACGTTCTCACATCTCTCTCAGAGG

GACTCACCACACTTG - UNI11366 - ACACAGTGGTCTCCTCCAGCTGCTGTACAAGTTTAGACTACATGGTCACCTATCTCTTCAAGCACATAGCA

AAAGAAGGGAAGAAGCCACTTCGAAGCAGAGAGGCTATGCAGGCTGGTCAGAGACTGTTACATTTTATGCAACAAAACCCAGATGTTCTGCAGCAG - U

NI2160 - ATGATGTCTGTCCTCATGAACACCATTGTCTTTGAGGATTGTCGGAACCAGTGGTCAGTATCCAGGCCTCTCCTGGGGCTCATCCTGCTCA

ACGAGAAG TATTTCAGTGAACTGAGGGCCAGTCTGATAAACAGCCAGCCTCTCCCCAAGCAGGAAGTCCTTGGCCAGTGCTTCAGGAACTTGATGGAAG

GAGTGGAACAGAACCTGTCTGTCAAGAACAGAGACAG GTTTACCCAGAACCTCTCCGTCTTCAGAAGAGATGTGGCAGAGGCCCTGCGTAGCGATGGCC

ACACTGACCTAAGCAGCCTGGACATGATGAGCTGACCCAGCTCCTGAGCGTGGGCTGTGCAGCCTTTGTCAAGAGAATCTGGAAGGTCTGGGTTCCAGAC

TACGATGCTGGCCAGCCCAGAAGAGTGTATTTTTCAGAACAAGCAGCTAAAGCCCTACATTTTTATAAGTCTGAGCTAATTATAAAAATTTATAATAGTG

CACATACAATGTAAATTCAGTATTCAAAGCAGCACATGTTTCAAGTCTATCTGGATTCCCACAATGCTAAAGGGTCTAGAAACTGTATTCAACCAAAGAA

CATAGTAAACCAGGCTAGTGCCTGTGACCACGGCTGTGGATTTGGTGAAGATGCAGCCCTCACTTCAGTGTGGGTTCTGGGTCGAGACAGATGCCATCTG

AACCTGTTGAATTCAATCTTTACATCTGGAAAATGCAATATTAGGGACTCGGGGCTGTGGGCATTGACAAGGAGCTTGGGAGGAAGCACCATAAAGCCTC

CCCCAGAACTGCACACAGGCCTTTCTGCCTCAGCAATATCTGATAAAGTTCAGAGACAGTAACACAATTAGATGACTAACAAACAATGTTTGCTTTCCAC

TGGCATAAATCTAAAGTGGTTCAGTCTAGAAGAATTAGCTCTGCAATTGCTGCCTGCAGAGAGATGTGTTTAGGACTCTGGAAGCCTAGTTAGAAGTTCT

AGGTGCACAAGCTCCATTTAACTTGAAGGAAAGCTGAGGGTGGCAAGTTGTATCTGGAAGCAGCTCTGCCTTCTGACCACCCAGCAGAGTTCAGCTGCCA

CCTTCTGCCCTCCGCCCTCCCTCCGCCTTCCACACGCTTAACCACTGTTGGATGTGACTTCATCCAAACATAGGAAATGAAGGCCTTTACAGCTTGTGAC

CCATCAAACCTAAGCTATTAATTTGGAATTGCCACTGTCAGGCGGGTTTCCTATCTCACTGCACTGACTTTGGCGTTCAGGCTTACAATAAACACTGCGG

CCATAATGTCTGATC
Translation
MALHFQ - UNI14321 - SLAELEVLCTHLYVGTDLTERIEAEKALLELIDSPECLSKCQLLLEQGT - UNI14321 - - UNI25861 - TSYA

QLLAATCLSKLVTRINPLPIEQRIDIR RNYILNYVASQPKLAPFVIQALIQVIAKLTKLGWFEVQKDEFVFREIIADVKKFLQ GTVEHCIIGVIILCE

LTQEMNL - UNI1186 - VDYSRPSAKHRKIATSFRDTSLKDILVLACSLLKQ - UNI18277 - VLAKPLNLQDQDQQSLVMQVLKLVLSCLNFD

FLGSSADESADDLCTVQIPTTWRTI - UNI30164 - IFLEPETLDLFFNLYHSLPPLLSQL - UNI30164 - ALSCLVQFASTRRSLFSSPERA

KYLGNLIKGVKRILENPQ - UNI4065 - - UNI30164 - GLSDPGNYHEFCRFLARLKTNYQLGELVLVKEYAEVIGLIANFTITSLQ HWEFAP

NSVHYLLTLWQRMVASVPFVKSAEPHLLDTYAPEITKAFITSRLESVAIVVR - UNI217 - RDNLEDPLDDTATVFQQLEQLCTVSRCEYEKTCTLL

VQLFDQNAQNYQKLLHAAPGLAVDMAIQEG - UNI217 - GRLAWLIYLVGTVVGGRLTYTSTDEHDAMDGELSCR RVFQLISLMDTRLPHCTNEKI

ELAVLWFLDQFRKTYVGDQLQRTSK - UNI2713 - VYARMSEVLGITDDNHVLETFMTKI - UNI15956 - IVTNLKYWGRCEPVISRTLQFLS

DLSVG GYILLKKLVKIDAVKFMLKNHT SEHFPFLGISETYNVGDFRCRTTFYTALTRLLMVDLG - UNI9281 - GEDEDEFENFMLPLTVSFETV

LQIFNNNFKQEEVK RMLIGLARDLRGIAFALNTKTSYTMLFDWI IYPAYLPVLQRAIERWYGEPACTTPILKLLAELMQNR - UNI12727 - RSQ

RLNFDVSSPNGILLFREASKMICTYG - UNI11792 - GNQILSLGSLSKDKIYPMKLKGISICYSALKSALCGNYVSFGVFKLYGDNHFDNVLQAFV

KMLLSVSHSDLL QYRKLSQSYYPLLECLTQDHMSFITNLEPPVLLYVLTSLSEGLTTLD - UNI11366 - DTVVSSSCCTSLDYMVTYLFKHIAKE

GKKPLRSREAMQAGQRLLHFMQQNPDVLQQ - UNI2160 - MMSVLMNTIVFEDCRNQWSVSRPLLGLILLNEK YFSELRASLINSQPLPKQEVLGQ

CFRNLMEGVEQNLSVKNRDR RFTQNLSVFRRDVAEALRSDGHTDLSSLDMMS

For any suggestions or comments, please send an email to unitrap@crg.es