Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040606 (9030409G11Rik)
Chromosomal location
Chr 4: 141658306 - 141795316 (-)
Description
RIKEN cDNA 9030409G11 gene Gene [Source:MGI Symbol;Acc:MGI:1918779]
RefSeq_peptide
NP_653114.3 NP_001103155.1 
UniGene
Mm.255986 Mm.400827 Mm.422344 
MGI
MGI:1918779 
Uniprot/SWISSPROT
Q69ZS8 
Uniprot/SPTREMBL
A2AC37 Q8BJ43 B1B0N1 
Human Ortholog
ENSG00000189337 (RP1-21O18.1)
Omim not available
UniTrap UNI10439
Vector Insertion
Chr 4: 141766128 - 141794899
Public Clones D063F08 (ggtc) D063D08 (ggtc) (ggtc) IST14784A6 (tigm) IST13077E9 (tigm)
IST14780A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27538
Vector Insertion
Chr 4: 141765929 - 141766122
Public Clones not available
Private Clones OST57287 (lexicon) OST55564 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8978
Vector Insertion
Chr 4: 141715096 - 141765929
Public Clones XD184 (baygenomics) RRE370 (baygenomics) RRD004 (baygenomics) PST3269-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17248
Vector Insertion
Chr 4: 141714958 - 141715096
Public Clones not available
Private Clones OST446748 (lexicon) OST439674 (lexicon) OST425492 (lexicon) OST415446 (lexicon)
OST406163 (lexicon) OST386076 (lexicon) OST379736 (lexicon) OST361002 (lexicon)
OST310369 (lexicon) OST295466 (lexicon) OST292766 (lexicon) OST283102 (lexicon)
OST263417 (lexicon) OST194991 (lexicon) OST193786 (lexicon) OST182637 (lexicon)
OST148214 (lexicon) OST144033 (lexicon) OST78386 (lexicon) OST62889 (lexicon)
OST56193 (lexicon) OST30577 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30040
Vector Insertion
Chr 4: 141714958 - 141766122
Public Clones (sanger) D142F11 (ggtc) PST17435-NR (escells) IST12152H2BBR1 (tigm) IST10830F3 (tigm)
IST10091B5 (tigm) IST10854F8 (tigm) IST15057H9 (tigm) IST15054H3 (tigm)
IST12064D3 (tigm) IST11601H3 (tigm) IST11646A5 (tigm) IST10899E5 (tigm)
IST14932C7 (tigm) IST12764B8 (tigm) IST10110B11 (tigm) IST11965C3 (tigm)
IST15057D11 (tigm) IST10018B6 (tigm) IST10282E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19777
Vector Insertion
Chr 4: 141710516 - 141714958
Public Clones not available
Private Clones OST380885 (lexicon) OST237509 (lexicon) OST226147 (lexicon) OST225257 (lexicon)
OST197397 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000070792
Sequence
CCCTAGTGCTCCTGCGGGAGGAAGTGGTCCAGCTTCAAGAGGAAGTGCACCTTCTCCGGCAGATGAAGGAAATGCTGGCGAAGGACCTGGAGGAGTCACA

GGGCGGCAAGTGCTCTGAGGTCCTCTCAGCCACTGAGCTCCGGGTGCAGCTGGTACAGAAGGAGCAGGAACTGGCCAGAGCCAAAGAAGCCTTGCAAG -

 UNI8978 - - UNI17248 - - UNI27538 - - UNI30040 - CCATGAAAGCTGACCGGAAGCGCTTAAAGGGCGAGAAGACTGACCTGGTG

AGCCAGATGCAGCAGCTGTACGCCACGCTGGAGAGCCGCGAGGAGCAGTTGCGAGACTTCATCCGCAACTATGAGCAGCACCGCAAG - UNI17248 -

 - UNI19777 - - UNI30040 - GAGAGTGAAGACGCAGTCAAAGCACTGGCCAAGGAGAAGGACCTGCTGGAGCGAGAGAAGTGGGAGCTTCGAC

GGCAGGCCAAGGAAGCCACAGACCATGCTGCGGCCCTGCGCTCCCAGCTGGACCTCAAGGACAACCGCATGAAGGAGCTGGAGGCGGAGCTCGCCATG G

CCAAGCAGTCCTTAGCCACTCTGACCAAGGATGTCCCCAAGAGGCATTCCCTCGCCATGCCCGGTGAGACGGTGCTCAATGGCAACCAGGAATGGGTGGT

GCAGGCTGACCTCCCACTGACTGCTGCCATCCGGCAAAGCCAACAGACTCTCTACCACTCACACCCTCCCCACCCTGCAGACCGGCAAG TCAGGGTGAG

CCCCTGCCACTCAAGACAGCCCTCCGTCATCTCTGATGCTTCTGCTGCTGAAGGTGACCGGTCATCTACACCAAGCGACATCAACTCCCCAAGACACCGG

ACACACTCCCTCTGCAAC GGCGACAGTCCCGGCCCAGTTCAGAAGAGCCTACACAACCCTATTGTACAG TCACTAGAGGATCTTGAAGACCAAAAACG

GAAAAAGAAGAAGGAGAAGATGGGATTCGGCTCCATCTCTCGAGTCTTCGCCAGAGGGAAGCAACGGAAGTCCCTCGACCCGGGCCTCTTTGATG ACTC

CGACAGCCAGTGCAGCCCCACACGCCACAGCCTCAGCCTGTCTGAGGGAGAGGAGCAGATGGACCGTCTGCAGCACGTGGAGCTGGTGAGGACCACGCCC

ATGTCGCACTGGAAGGCTGGCACAGTGCAGGCCTGGCTGGAGGTGGTGATGGCCATGCCCATGTACGTCAAGGCCTGTGCAGAAAATGTCAAGAGTGGGA

AG GTGCTTCTCAGCCTGAGTGACGAGGACCTGGAGTTGGGCCTGGGAGTGTGCAGCTCCTTGCACAGGCGCAAGCTCCGCCTGGCCATTGAGGACTACC

GAGATGCTGAGGCAGGCCGCAG CCTGTCCAAAGCTGCCGACCTGGACCATCACTGGGTGGCCAAGGCCTGGCTGAATGACATTGGCCTGTCCCAGTATT

CCCAGGCCTTCCAGAACCACCTGGTTGATGGGAGGATGCTGAATTCACTGATGAAGCGGGACCTGGAGAAACACCTGAACGTGTCCAAGAAGTTCCACCA

AGTTAGCATCTTGCTGGGAATTGAGCTGCTGTACCAAGTGAACTTCAGCAGGGAG GCTCTCCAGGAGCGCAGAGCCCGCTGTGAAACACAGAACACAGA

CCCTGTGGTCTGGACCAACCAGCGGGTGCTCAAGTGGGTGCGCGATATCGACCTGAAG GAGTATGCAGACAACCTGACCAATAGCGGTGTCCATGGTGC

TGTGCTGGTCCTGGAGCCCACATTCAATGCCGAGGCCATGGCCACCGCCCTGGGCATCCCCAGCGGGAAGCACATACTCAGGAGACACCTGGCAGAGGAG

ATGAGCACCATCTTCCATCCATCCAA CTCCACAGGCATCCGGGAGTCTGAGCGCTTTGGGACACCACCTGGCAGGGCCTCTAGCATCACCAGAGCTGGG

AGAGAGGACAGTGGGGGCAATAGCAAGCACAGAGCTGGCCGG CTGCCCCTGGGGAAGATAGGAAGGGGCTTCAGCAGCAAAGAGCCCGATTTCCATGAT

GACTATGGCTCTCTGGAGAACGAGGACTGTGGGGATGAGGACCTCCAAGGCAGGCCGGAACAGTGCCGTCTGGAGGGATACGGCAGCTTGGAGGTCACCA

ATGTGTAAGAAAGCCGCGTGACTCAACTCCAGAAGAGAACAGGGAGAAGGGACAGCCCAACGTCCCAGAGCCGTCCATCCCCACTGTACAGCATGACCCG

GAGCCGAGGACAGACAGGGTGTCAGAACAGAGTTCCCAGAGATGGTCACAATTTCCAGGGGGGCACCAAGGACAGAGAATGCCCACCTAGGTATCTTGTA

TCTCTGAGGAAGTATCCCCAGCTGCGCGACCCAGCAGGTGGCCCTGGGGCTGCTGTTCAAAGTAGAAGTCAGGTGCCACTGGTATTTTACACTGGTCAAG

GAGGGGCAGTCAGTCTTTGGGCCTGGAACACCCTGCTAAGAGGAGCAGGGAAACCCCCAGCCTGCCTTGGCAAAGCCAGGGCCGCTGGGATCCGGTGGCA

AAGCCAGCTAGCAGCGGCCAGGTGGTGATTGTTGACTGTCAGCCCGCTGGGCAGAGAACTTGAACTCTGACCTCACTCACTCCAGAAGGAGGCGGAACGG

CCTGGGCATCCCTTCCACTTTAAGGGTGGACATGTTGGGAGCAGGAGGGGGAATCTCTGCAGGGCACAGGTGCCTGACAGCAGCAGCCCTAGGGGCTACA

GACATCCTGTCACCAGAATGAATGTGACTTCAAGAGTGGGAGGGGGGTGGTTGCTGTGCTCTGTCCCAAACAGCTATTCCGAGTGTGCGCATGACATGGG

AGACAGCCTGTCATTAATCTGACAAACCTCTCTTGTGATGTCCCTGTCAGCTGAGACAGGTAAGCTCACCCATGAGCTAACGGAGGTGCAAATCCTACAA

AACAAGGTCACCCCGGTTGTCAGAGTAGGGCCTTTCTAGCCGCTGTCCTGATCTGCCAGTGTTTTTGCTGTGTGGCTTCCCCTCAATGGCCTCACCTCTC

TGTGCCTCAGTGTCTTACCTGTCATACTTCCGGTTCCTCCCAGAGGAGCTGTGAGGATTAACATTCACTAACATTTGTCCCGAGCTTTGAACCTCTCAGG

AAACAGCTGGAAGGGATGGGGCAGGGGAGGAAGGAGCCTAACTTCCATCCACAACATTGGCAGACACCGGGCGAGTTCACCCCATTTTTGGATAGGGAGA

TAAGCAAGAGGGGCTTGCAGAAAGTTTAATATCGAGAGTTTCCAAAAGCCATCGGTGAGGTCTGGGAGAGCCACCAGCACAGCCTGCGGGCCTACTGGGT

GCAGGGTCCAAGCTGACTGAGCAGAGCCTGCCTATTGATGATAGGGAGGATTTCGGTGTAGCTGTGCTCAGTCAGTACCAGCTCTCCTCAGATTCCCACA

GCTGACGGCAGTCGGTGGGGGTGGGGGTGGGGCACTGCCTCTGAGTCACCAAAGCCAGTCTTCTGCATTGTTTCTGAGAGCTTCCCTTTGCGGGAAGACC

ACAGGAAGCCTGAGAACTTGGAGGAGGATTCCCTGAGTCCCCCAGGTCCAGTCTCCTTCCCAACCTGAGTCCAGGGCCCTCGGGGACTGGGAGGAACCTC

TCTGTCTGAGTGTCAGCCTCCGAAGGACACACGGCGGACACCAGGACTTGCAGGGTCAACCTCTGGGGTAGAATCCAGCTTGGCTCAGGCTCCACATCCC

TGAGTGTTTATAACACGCATTCCCCTGCCCCTGGAATCCTGAAGCTACAAATCCCTTAGCCCAGCAAAGAGAGGGGAAGAAGGTCCTCTTCTAATTGAAG

CCAGCTGTCACTTTCACACCAAGTCCCCAAAGGGTGACAAAGCTTCTGGAGCCAGGAGGATACTGAGAGCCTTCCTGGAAATGTCGCTGGCGATGTGGGC

TCCTTTCAAGGGCCAAGGTCTAGGTAGGGAGAGACTCACACTTTCTTCCCACGGGCTCGGAGGCCCACGGCATCTGAAGGCTCCTTCCCAATGGACTCTG

GGCTTCAGTCCTGGGCACCTCTGTCAGTCTCCATCCACATCCAGTGTCACTTTTAGCAGATTCTCTGTCTTGACTCCTCACCACAGGATGCAGGGGTTGT

CAGGGGACTAGAGTCAGAAGTGGAGAGAGGGGCTCTCTCCTAAGCCCACCCTGCATAGGGCACTTAGAACAGGGAACCCCGCCAAAGACCGAGGTCATGA

AAAGGGGTGGGGTCCTGGCAGATGTAAATTCGGACGGCAGGATCACGATGAAGAACTCTAAGAGAATTATGACAGCCCTTCCCAGAAGGCCAAGGACCAC

GTCACAGGTTGTGGGGGAACGTGGCTCCTGAGTGGTGGCACCTTCTGGGTGTCACTTTACAGAAGCCAGCATGGATGGTGACGATGTCCCTCCCTGACCC

ATGGAGGGTTTGTAAAATGCACGGCAAATGAACAGTGAACTGCAGTGTCCCATGCCTTCCCAGAGGGAATTTTAACAATGTAACAATAAATGCTTGGCCT

TGAAGCT
Translation
 - UNI8978 - - UNI17248 - - UNI27538 - - UNI30040 -  - UNI17248 - - UNI19777 - - UNI30040 - MKELEAEL

AM AKQSLATLTKDVPKRHSLAMPGETVLNGNQEWVVQADLPLTAAIRQSQQTLYHSHPPHPADRQV VRVSPCHSRQPSVISDASAAEGDRSSTPSDIN

SPRHRTHSLCN GDSPGPVQKSLHNPIVQ SLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLFDD DSDSQCSPTRHSLSLSEGEEQMDRLQH

VELVRTTPMSHWKAGTVQAWLEVVMAMPMYVKACAENVKSGK VLLSLSDEDLELGLGVCSSLHRRKLRLAIEDYRDAEAGRS SLSKAADLDHHWVAKA

WLNDIGLSQYSQAFQNHLVDGRMLNSLMKRDLEKHLNVSKKFHQVSILLGIELLYQVNFSRE ALQERRARCETQNTDPVVWTNQRVLKWVRDIDLK EY

ADNLTNSGVHGAVLVLEPTFNAEAMATALGIPSGKHILRRHLAEEMSTIFHPSN NSTGIRESERFGTPPGRASSITRAGREDSGGNSKHRAGR LPLGK

IGRGFSSKEPDFHDDYGSLENEDCGDEDLQGRPEQCRLEGYGSLEVTNV
Transcript ENSMUST00000036476
Sequence
AGGATCTGGAGTTGTTCCCACGTGAGAGGATCGCGCCGGATTCCTCCGGTGCGGCGGCCGCGGAGTGCCCGGCGCTCGGTGGGGCTGAGATCTCTGGCCG

GGAGCGCGTGGGCGACCCGATGCGGCGGCGGCTCCGAGGGCTGTGAGACCGGCGTCCGCCGTCGGAGCCCCGCGCGCCGCCGTGGGGCCTCGCGTCCCGG

GCACACGGGATGCGGGCGGCCGATTCGGGTTCATGGGAGCGCGTCCGCCAGCTTGCGGCATACGGCCAGCCGACTCCGTCCTGCGGGCGGGACACCGGGT

CCGCGCGCGTCCCGGAGCCCGGAGCCTGCAAGCTATGCGCGGACACTACGGGGCTCCGGGAGCAGCAGGGAGCTGGAGCAGTCCCCGATGCAGCCGATGG

CTTCGGCATCCAGCCCG - UNI10439 - - UNI27538 - - UNI30040 - TGCTCCTGCGGGAGGAAGTGGTCCAGCTTCAAGAGGAAGTGCA

CCTTCTCCGGCAGATGAAGGAAATGCTGGCGAAGGACCTGGAGGAGTCACAGGGCGGCAAGTGCTCTGAGGTCCTCTCAGCCACTGAGCTCCGGGTGCAG

CTGGTACAGAAGGAGCAGGAACTGGCCAGAGCCAAAGAAGCCTTGCAAG - UNI8978 - - UNI17248 - - UNI27538 - - UNI30040 -

 CCATGAAAGCTGACCGGAAGCGCTTAAAGGGCGAGAAGACTGACCTGGTGAGCCAGATGCAGCAGCTGTACGCCACGCTGGAGAGCCGCGAGGAGCAGT

TGCGAGACTTCATCCGCAACTATGAGCAGCACCGCAAG - UNI17248 - - UNI19777 - - UNI30040 - GAGAGTGAAGACGCAGTCAAAG

CACTGGCCAAGGAGAAGGACCTGCTGGAGCGAGAGAAGTGGGAGCTTCGACGGCAGGCCAAGGAAGCCACAGACCATGCTGCGGCCCTGCGCTCCCAGCT

GGACCTCAAGGACAACCGCATGAAGGAGCTGGAGGCGGAGCTCGCCATG GCCAAGCAGTCCTTAGCCACTCTGACCAAGGATGTCCCCAAGAGGCATTC

CCTCGCCATGCCCGGTGAGACGGTGCTCAATGGCAACCAGGAATGGGTGGTGCAGGCTGACCTCCCACTGACTGCTGCCATCCGGCAAAGCCAACAGACT

CTCTACCACTCACACCCTCCCCACCCTGCAGACCGGCAAG TCAGGGTGAGCCCCTGCCACTCAAGACAGCCCTCCGTCATCTCTGATGCTTCTGCTGCT

GAAGGTGACCGGTCATCTACACCAAGCGACATCAACTCCCCAAGACACCGGACACACTCCCTCTGCAAC GGCGACAGTCCCGGCCCAGTTCAGAAGAGC

CTACACAACCCTATTGTACAG TCACTAGAGGATCTTGAAGACCAAAAACGGAAAAAGAAGAAGGAGAAGATGGGATTCGGCTCCATCTCTCGAGTCTTC

GCCAGAGGGAAGCAACGGAAGTCCCTCGACCCGGGCCTCTTTGATGGTACCGCCCCTGATTATTACATAGAGGAAGACGCGGACTGGTGATAACCCACCG

CCCTTCGCCCATTGCCCACGGGCGTGTCTGTGTGTGGATGAGCCATGGAGCGTGCGAGAGAGTGTGTGTGCGTGGGGGTGCGGAGCTTGTGTGGGGTGTG

TGTGTGCACGGATGCACTCACCCTCATGGGTGTGTGTAGCTAAGCGCCTGGAACAGGCAGAAACACAAATGTGACCCCACACCCCCTCCGCGTCGTCACC

TCTGTAATCGATGTACATACCACAAACCGTGTGTGACTCTGTCAACGCTGTTGTCTCCGAGAGATACACTTGTGTTTGTTTTTTCTCGTTTGTTTTTGTT

TTTGTTTTTCGATGTTTTGGGGGTTTTGTTTGTTTGTTGTCTGTTTAATGCGTTGTGTTTTTGTTTTTAATTTGCCCCTTTCTCTTCCCTCCTCCTTTTT

ATGAAACTTGAACACTTGAAGGACTGCTGTGTATTTGTAAATAACAAAAGTAGTGTGCACTTTGTGCTTGTAAAGTCCCTGGTCCAGCCAGCCGCTACTC

TTACTGCAGCCCATGTCGCCAAGAACGTGGTCTGTTTTTCATGTTCCCCTCCTCCCGACCCTTCTTCGGTGTGAACGTGTGGGACCAGACCCTGTTCTCG

GGGTGTGCCCGAGTCACTTTAACCACAAAAACACCCCGCCATCGTCGTCAGGGTAAGGTCACTCTGCAGAGACTCTCGTGAGCACATCCAAGACTTCTTG

GCTGGGCTGCAGTGTTTATAAGGGGGTCATATGGGCTCTTTTTAATGGCCTGCCTGTTTTTAAATTGTGTTGCTGTTTCTTTCTTTATGGAACAAAAAGA

GAGAAAGAAAACTGTTGCATTTAATTTATTTGCACAAATGCAGAAAACGTATTCTATCTAAATTATTACATAAATATTGGAATGTATATTTTTCCACGGG

GTGGGCGGGAGGCGGGCATTTCTGCGGACTTGTCTGTTCTGTGTTCATGCCGCTGCAGACACTGTGCAAGGTAGAATTCAGGTGGCTAGAGCTGGGGACC

TCAGACGACCAGCTTGCTTATTTCTTTTTTTTTTCTCTTTTTTCTGTCTCTCCCGGCTGCTGTCCCTGCATGAGAGAACTCCCACCTTCTGCTCTGGCCT

TTCTCTCTACATGTATCCTCTCTTTATATATATATATTTATTTATCTGACATGCAGATCGTGACTTAAGTGAGCAGAGCGCCAACAGTCACGTTCCCCCC

TCTCTTGGACCTGTCTTTGGAGTCATGTGGATTGAGTGCAGGGAAGGATAGCCTGAGATAGCCTGGGGCACATCCGTGGAGGTCTAACCAGACATCTGGG

CTTGAGTCAGTGGGTAAGAGGCCCCCGGTGGTGCACACAATGCCTCTCCATCCTTAGTTTATTCCAGACGTAGGCCAGGCCGGTGTCAATAGAGAAGATG

CCCACCTCCTGGGAAGGGCTGTTGGGGACAGTATCTAGCAGGCAAGCCCTCTGCCCTCTTTTGTCCTGTTGGCTTCTTTGGCCACGCGTGGACTTTCCCA

TGATCCCCAGAGCCCTGTCCTCTGATTATATCAGCAGCTCGAGCAGACTAAGCCCAAGAGGGCTGGCAGGTGCCTGTACCTGTGCCTGTTTGTGGGGCAT

CACTGTCCCCACGGGGCTGCACTGGGGCCTGGAGAACCCACAAGTTTCCAGTCAGTGCTTACTGCCCTACTCCCCGGAACTCAGTTTCCTCTTTCTTTCC

CTCCCCGTCCCCTCTAACTGATCCTAAACCACTAACAACTCATCCCTCATCCCTTGTGGCCACTGCAGTGCTCCCCCTAACGGAAACATTCTCCACTCTT

GAAAAGTGAGTTTTCAGTGCTTGATGGAACATCTGGAATGTATAGGATCTTGTGTCCAAAGTCTCTAAAAAACAAGCCAAAAAGCCCCCACCAGGTCACC

TCTTCCCTCCCAACCTGGCCCCAGAGGCAGAGAGAGAGAGCAAGCAGGGACACCTAATGCCACCCTGTGTGTACAAACCGTTCAGCTCAGCTGATTAACC

CAGCCTGGTGTTAAGGGAGAGAGGCCAGAGCTGGTCTTAGAAAACACTACCCCCACCCCCTGAATTTTTTGGGTTTTATTTTATTTTGTTTTTTATGGTT

CCGCCCTCCCTTCCTTTTACTTACAAGAAGATAAGATTGCAACCTCTCCTGGTAATGACTTAGTCATTCTTTTTCATTTCAGTTTTTGGAAATTAGGAGG

ATCATCCTATGAGTTACTAAGGATGATTTTATTTGAGAGAATCACATCAAATAGGGACTGAGTTATGGGTAACTCTAGATGAAAATGACCTTTTCCCATG

GGAGAGGTTTCTCGAAGGCATGGATGCAAAATATAAAATATTAAAAAAAAGTCTAAATAAAGCTTATTTTAAAAT
Translation
MRAADSGSWERVRQLAAYGQPTPSCGRDTGSARVPEPGACKLCADTTGLREQQGAGAVPDAADGFGIQPV - UNI10439 - - UNI27538 - - U

NI30040 - VLLREEVVQLQEEVHLLRQMKEMLAKDLEESQGGKCSEVLSATELRVQLVQKEQELARAKEALQA - UNI8978 - - UNI17248 -

 - UNI27538 - - UNI30040 - AMKADRKRLKGEKTDLVSQMQQLYATLESREEQLRDFIRNYEQHRK - UNI17248 - - UNI19777 - 

- UNI30040 - ESEDAVKALAKEKDLLEREKWELRRQAKEATDHAAALRSQLDLKDNRMKELEAELAM AKQSLATLTKDVPKRHSLAMPGETVLNGN

QEWVVQADLPLTAAIRQSQQTLYHSHPPHPADRQV VRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSLCN GDSPGPVQKSLHNPIVQ SL

EDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLFDGTAPDYYIEEDADW

For any suggestions or comments, please send an email to unitrap@crg.es