Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040652 (Oaz2)
Chromosomal location
Chr 9: 65524397 - 65538104 (+)
Description
ornithine decarboxylase antizyme 2 Gene [Source:MGI Symbol;Acc:MGI:109492]
RefSeq_peptide
NP_035082.1 
UniGene
Mm.116749 
MGI
MGI:109492 
Uniprot/SWISSPROT
O08608 
Human Ortholog
ENSG00000180304 (OAZ2)
Omim not available
UniTrap UNI16111
Vector Insertion
Chr 9: 65524573 - 65534002
Public Clones (sanger) E041H04 (ggtc) IST14329D12 (tigm) IST15049G11 (tigm) IST14903F2 (tigm)
IST14738G12 (tigm) IST12371B3 (tigm) IST14705H8 (tigm)
Private Clones OST466477 (lexicon) OST437006 (lexicon) OST421299 (lexicon) OST402713 (lexicon)
OST316215 (lexicon) OST308549 (lexicon) OST297559 (lexicon) OST286578 (lexicon)
OST275143 (lexicon) OST261873 (lexicon) OST260901 (lexicon) OST260729 (lexicon)
OST260701 (lexicon) OST259557 (lexicon) OST252442 (lexicon) OST249415 (lexicon)
OST243916 (lexicon) OST226467 (lexicon) OST215668 (lexicon) OST166196 (lexicon)
OST165319 (lexicon) OST134915 (lexicon) OST129941 (lexicon) OST129405 (lexicon)
OST113895 (lexicon) OST113330 (lexicon) OST98906 (lexicon) OST37360 (lexicon)
OST35346 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28285
Vector Insertion
Chr 9: 65534079 - 65534079
Public Clones not available
Private Clones OST35005 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22336
Vector Insertion
Chr 9: 65534161 - 65535604
Public Clones IST14475A1 (tigm)
Private Clones OST299889 (lexicon) OST274638 (lexicon) OST221690 (lexicon) OST196863 (lexicon)
OST193774 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18135
Vector Insertion
Chr 9: 65535781 - 65536627
Public Clones not available
Private Clones OST429455 (lexicon) OST281081 (lexicon) OST260665 (lexicon) OST122614 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23828
Vector Insertion
Chr 9: 65536714 - 65536901
Public Clones not available
Private Clones OST243325 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046490
Sequence
GGCGCTCGCTGAGGCAAGAGGAGGGCACTCGGCCCGCGGCCTGACAGGGACTTAGCCCACAGAGACCGGCCCGCGCGCGCGACCCCACACCCACCCACTC

GTCCACCTACCCACTCCCCGCGCCGCCTCCTCCCACCCTGAGCAGAGCCACCGAGGATGATAAACACCCAGGACAG - UNI16111 - TAGTATTTTG

CCGTTGAGTAAGTGTCCCCAGCTCCAGTGCTGCAGGCACATTGTTCCAGGGCCTCTGTGGTGCTCC - UNI28285 - GATGCCCCTCACCCACTGTC

GAAGATCCCCGGTGGGCGAGGGGGCGGCAGGGATCCTTCTCTCTCAGCTCTAATATATAAG - UNI22336 - GACGAGAAGCTCACTGTAACCCAGG

ACCTCCCTGTGAACGATGGAAAACCTCACATCGTCCACTTCCAGTATGAGGTCACCGAGGTGAAGGTCTCTTCCTGGGATGCAGTCCTGTCCAGCCAGAG

CCTGTTTGTAGAAATCCCAGATGGATTATTAGCTGATGGGAGCAAAGAAGG - UNI18135 - ATTATTAGCACTGCTAGAGTTTGCTGAGGAGAAGA

TGAAAGTGAACTACGTCTTCATCTGCTTCAGGAAGGGCCGGGAAGACAGAG - UNI23828 - CTCCACTCCTGAAGACGTTCAGCTTCTTGGGCTTT

GAGATTGTGCGTCCAGGTCATCCCTGTGTCCCCTCTCGGCCAGATGTGATGTTTATGGTTTACCCCCTGGACCAGAACTTGTCTGATGAGGACTAATGGT

CACAGAGGATGCTTTGCCTAAGAGCCACAGTGGGGGAAGAGGGGAAGTTAGGCAGCCTTGGGACAGAGGAGAGGGTCTCTGGCTGTCTAGGGAAGGACAT

TGAGGGGCTCAGGTTGAGGGTTGCCCATTGTGTTCTCGGAGTTGACTCGTTGAAATTGTTTTCCATAAAGAACAGTATAAGCATATTATTCACATGTAAT

CACCAATAGTAAATGAAGATGTTTATGAACTGGCATTAGAAGCTTTTTAAACTGCGCTGTGATGTGCTCCATCTACCCTAGGGGAGGACATTGCCTGCAG

GGGCGGGACTGCCGGGCCCAGGACAGGCCTGGAGGGCTGGTGGGCAGGACTGTCAGGCTCAGGTCTCCTTGGAGTTGGGCTTTCTTCTTTTGGTTTTGAA

GACTTAGGTATTTTCTTTCTTTGCTTCTTGTCATCTAGGGGCTCCTGAGTATAGGCTTTAGCTCCTGGGCAGTGTCCTTGGGTTGTCTTCAACACTCCAC

CTTGAGCTTCTGGCATTTTGTGTCTGGCCTGGTGTAAGCAGGTCTGACCTTGCTTTCTTTACAGCTTAGTGTTATTCTGGCATTTGGTTAAGCTGGCTTA

ATCTGTTTAATGTTACCAGTGCATTTTAAATAGGGGCATTGAAACTCACTCCCCCACACCAGGGCTTTTTGGGGGGTGCCTGGGCCTTAAGAAACTAGCC

AAACTACATCTCAAGTTACCACCAGAGCTCTTGCCTCTGTGGCCTAGGCCCCAGGATCTCTTTCCTTGCAAGAGCAGAGAGGAAGAATACCAAACTCAGG

GCCTGGGGTTTGTGGGGGAGCCTGTTCTTAGCGCCTGGATGCCTCTGGCTGGCCAAGCACAGTACTGCCTGCCTCCTTAACAGGTTCAGAACAGTGCCTG

CGCTGCAGAGCTGAGAGGTAGGGCTGGACTGCAGAAATGGCCTGCCTTTTACTGCTTTCACCAAACAGCTTGTTCTAAAGAGAAAAGGGAGAGAGATCTA

CATTGGGTGTGGGGGTGTCAGGGAGACAAGTGTGTTGTGTTACTGTGTCAATAAACTGATTTAAAGTT
Translation
MINTQDS - UNI16111 - SSILPLSKCPQLQCCRHIVPGPLWCS - UNI28285 - DAPHPLSKIPGGRGGGRDPSLSALIYK - UNI22336 

- DEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEG - UNI18135 - GLLALLEFAEEKMKVNYVFICFRKG

REDRA - UNI23828 - APLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED

For any suggestions or comments, please send an email to unitrap@crg.es