Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040661 (Rad54l2)
Chromosomal location
Chr 9: 106590413 - 106691544 (-)
Description
Rad54 like 2 (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1933196]
RefSeq_dna
NM_030730 
RefSeq_peptide
NP_109655.2 
UniGene
Mm.246689 Mm.414176 
MGI
MGI:1933196 
Uniprot/SWISSPROT
Q99NG0 
Uniprot/SPTREMBL
O35695 
Human Ortholog
ENSG00000164080 (RAD54L2)
Omim not available
UniTrap UNI7391
Vector Insertion
Chr 9: 106656470 - 106691310
Public Clones (sanger) RRS530 (baygenomics) P028F11 (ggtc) E042H01 (ggtc) E076E06 (ggtc)
D183A09 (ggtc) E044E05 (ggtc) D178B03 (ggtc) E032G02 (ggtc) E066C10 (ggtc)
D178C04 (ggtc) E002B02 (ggtc) FHCRC-GT-S18-3E1 (fhcrc) IST10061D11 (tigm)
IST14621H2 (tigm) IST14485A8 (tigm) IST14232F10 (tigm) IST10053G6 (tigm)
IST14634D11 (tigm) IST14307B10 (tigm) IST10454C11 (tigm) IST14999C2 (tigm)
IST11613G7 (tigm) IST10746F8 (tigm) IST14578D5 (tigm) IST10043A7BBR1 (tigm)
IST12663D8 (tigm) IST14755B11 (tigm) IST10043B8 (tigm) IST14817C12 (tigm)
IST14175C5 (tigm) IST14152E12 (tigm)
Private Clones OST449362 (lexicon) OST444582 (lexicon) OST435241 (lexicon) OST426538 (lexicon)
OST414788 (lexicon) OST408551 (lexicon) OST390739 (lexicon) OST388735 (lexicon)
OST373358 (lexicon) OST370054 (lexicon) OST366105 (lexicon) OST360755 (lexicon)
OST346983 (lexicon) OST341704 (lexicon) OST326638 (lexicon) OST318333 (lexicon)
OST318213 (lexicon) OST303179 (lexicon) OST303026 (lexicon) OST302054 (lexicon)
OST293126 (lexicon) OST290936 (lexicon) OST287019 (lexicon) OST280361 (lexicon)
OST280321 (lexicon) OST274148 (lexicon) OST270934 (lexicon) OST270050 (lexicon)
OST266222 (lexicon) OST265956 (lexicon) OST261757 (lexicon) OST246083 (lexicon)
OST236947 (lexicon) OST226917 (lexicon) OST186008 (lexicon) OST185464 (lexicon)
OST180492 (lexicon) OST171811 (lexicon) OST162569 (lexicon) OST138885 (lexicon)
OST51894 (lexicon) OST37567 (lexicon) OST30251 (lexicon) OST30181 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5981
Vector Insertion
Chr 9: 106625246 - 106656275
Public Clones CSH391 (baygenomics) CMHD-GT_247F4-3 (cmhd)
Private Clones OST461241 (lexicon) OST459000 (lexicon) OST449625 (lexicon) OST397242 (lexicon)
OST379897 (lexicon) OST379538 (lexicon) OST378790 (lexicon) OST364748 (lexicon)
OST342135 (lexicon) OST323801 (lexicon) OST238257 (lexicon) OST220201 (lexicon)
OST214680 (lexicon) OST212652 (lexicon) OST205592 (lexicon) OST132875 (lexicon)
OST102763 (lexicon) OST100399 (lexicon) OST65886 (lexicon) OST34478 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1892
Vector Insertion
Chr 9: 106605173 - 106605822
Public Clones BA0041 (sanger) AY0487 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35644
Vector Insertion
Chr 9: 106590412 - 106598296
Public Clones IST10497H9 (tigm) IST13645B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046502
Sequence
GGGAGGGGGAAGCTTTCTGGCGCGGACCGCGAGCGGAGGCTGAGAGCGCCGCCGCCGGAGAAGACCGACCCTCGGCCAGAGCCAGCCTGCGGCGCCCGGG

CCTGGCTGGCTGCTTCCCGCCTCAGCCGCTTCTCCGGCTCCCGCCGCCGCAGACACTGTCCAAGAGGGTGCGGCAGAACGCGAGGTCCTACGGCCCAGCC

CGGTCCGGTGCGGCCCGGATCCGTGGCACGGGAG - UNI7391 - GACCCTACTGTGGACATGAGTCGGTAATGCCCACTGAGGACTTCTGGGAGCCA

TGTCAGACGAATCCGCCTCAGGGAGCGATCCAGACCTGGACCCGGACGTGGAGCTGGAGGATGAGGAAGAGGAGGAGGAGGAGGAGGAGGAGGTGGCAGT

GGAGGAGCATGACAGGGATGACGAGGAAGGCCTGCTGGATG - UNI5981 - ACACATCCCTGGAAGGCATGTGTGGCACTGAGCATGCCCAGCTGGG

GGAAGATGGGCAGCGGCCGCCGCGGTGCACTTCAACTACCTCATCTCAGTCTGAGCCTTCAGAGCAGCTTAGGCACCAAGGCAAGATCCTAGCATCCGAG

GACCCCAAAAAGAAGCGAGCTCAGAAGCCCTCTCACATGAGAAGAAACATACG AAAGCTACTCCGGGAGGATCAGTTGGAGCCCGTAACCAAAGCAGCA

CAGCAGGAAGAATTGGAAAGAAGAAAGCGCCTGGAGCAGCAGAGGAAAGAATATGCAGCCCCCATTCCTACTGTCCCTTTGGAGTTCCTACCTG AGGAA

ATTGTCTTACGAGCTAGTGATGGTCCCCAACTCCCACCTCGGGTCTTAGCCCAGGAAGTCATTTGTTTGGACAGTAGCAGTGGCAGTGAGGATGAAAAGA

GTAGTCGAGACG AGGTAATTGAGCTGAGTTCTGGAGAGGAGGATACGCTGCACATCGTGGACAGCAGTGAGTCTGTCAGCGAGGAGGACGAGGAAGAGG

AGAAGGGTGGCACCCATGTGAATGACGCCTTAAACCAGCATGATGCTCTCGGGCGGGTCCTTGTCAACCTGAATCACCCTCCAGAGGAGGAGAATGTCTT

CCTGGCCCCCCAGTTGGCACGGGCTGTGAAACCTCATCAG ATTGGTGGGATCCGGTTCCTATATGATAACCTAGTGGAGTCCTTAGAAAGGTTTAAGAC

CAGTAGTGGCTTTGGCTGTATCCTGGCCCATAGCATGGGCCTGGGGAAAACTCTGCAAGTGATCTCCTTCATTGATGTCCTTTTCCGCCATACGCCAGCC

AAAACAGTCCTTGCCATTGTGCCG GTGAACACTCTTCAGAATTGGTTGGCAGAGTTCAACATGTGGCTCCCGGCTCCTGAAGCCCTCCCAGCCGACAGC

AAGCCTGAAGAAGTCCAGCCTCGGTTCTTTAAAGTTCATATCTTGAATGATGAACACAA GACGGTGGCATCCCGTGCTAAAGTGACGGCTGATTGGGTT

TCAGAGGGTGGAGTGCTACTGATGGGGTATGAGATGTACAGACTACTCACACTGAAGAAGTCCTTAGCCACAAGTAGGCCGAAGAAAACCAAGAAACGCT

CTCATCCCGTCATCATTGATCTGGATGAAGAAGACCGGCAGCAGGAGTTCCGGAGAG AGTTTGAGAAGGCCTTATGCCGCCCTGGTCCTGATGTGGTGA

TCTGTGACGAGGGACACCGCATCAAAAATTGCCAAGCCAGCACCTCACAGGCTCTGAAGAACATACGTTCTCGTCGGCGGGTAGTGCTGACTGGCTACCC

TCTACAGAACAACCTCATTGAGTACTGGTGCATGGTGGACTTTGTGCGCCCAGATTTCCTTGGTACTCGTCAGGAGTTTAGCAACATGTTTGAACGCCCT

ATCCTAAACGGACAGTGTATTGACAGCACACCTCAGGATGTCCGCCTCATGCGCTACCGGAGCCATGTTTTGCACAGCCTCCTGGAGGGCTTTGTGCAGA

G GAGAGGCCACACTGTGTTGAAGATTCACCTCCCTGCCAAAGAAGAGAATGTGATCCTGGTGCGGCTTTCTCAGATCCAGCGAGATTTGTACACACAAT

TCATGGACCGTTTCCGGGATTGTGGTACCAGTGGCTGGTTAGGGCTGAATCCTCTGAAGGCTTTCTGTGTATGCTGCAAG ATCTGGAACCATCCTGATG

TGCTGTATGAAGCCCTTCAGAAGGAAAACCTAGCCAATGAGCAAGACCTAGATGTGGAAGAACTTGGCTCAGCGGGGACCAGTGCCCGCTGCCCACCACA

TGGCACAAAAGTCAAGGGAGAAGATAGTGCCTTGCCTTCCTCAATGGGAGAAGCAACCAACAGCAAGTTCCTACAGGGAGTTGGCTTTAACCCTTTCCAG

GAACGGGGCAATAACATTGTTACATATGAGTGG GCCAAGGAGCTTCTGACTAATTATCAGACTGGAGTCCTGGAGAACTCTCCCAAGATGGTACTGCTT

TTCCACCTGATTGAAGAAAGCGTGAAGCTCGGGGACAAGATTCTTGTATTTAG CCAGAGCCTTTCTACCTTGGCTCTCATCGAGGAGTTCCTAGGGAAA

CGAGACATGCCTTGTCTGCCTGGTGCCGAGGGGCAAGGAACACAGAAGTGGGTTCGAAATGTCAGCTACTTCC GGCTAGATGGTAGCACCCCTGCCTTT

GAGAGGGAGCGGCTCATTAATCAGTTCAATGATCCCAGCAACCTCACCACCTGGCTGTTCCTTCTCTCCACAAG GGCCGGATGCTTGGGGGTGAATCTG

ATTGGTGCCAATCGAGTGGTGGTATTCGATGCTTCCTGGAACCCTTGCCATGATGCCCAGGCAGTATGTCGGGTATACCGTTATGGCCAGAAAAAGCCCT

GTCACATCTATCGACTCGTGGCTGATTATACTCTTGAGAAGAAGATATATGACCGGCAGATTTCCAAGCAGGGCATGTCAG ATCGGGTAGTGGATGATC

TAAATCCAATGCTGAACTTCACCCGGAAGGAAGTGGAAAACCTGCTGCACTTTGTTGAGAAGGAGCCAGCTCCCCAAACATCTTTGGATATAAAGGGGAT

CAAGGAGTCAGTCTTGCAACTTGCCTGCCTGAAGTACCCTCACCTCATCACCAAG - UNI1892 - GAGCCTTTTGAGCACGAGTCATTGCTCCTCAA

CCGAAAAGATCACAAGCTGACCAAAGCTGAGAAGAAAGCAGCAAAGAAAAGCTATGAGGAGGACAAACGCACATCAGTACCCTATACCCGCCCATCATAT

GCACAGTATTACCCTGCCAGCGACCAGAGCCTGACCAGCATCCCTGCCTTCAGTCAGAGGAACTG GCAGCCAACACTGAAGGGTGATGAAAAGCCTGTG

GCCAGCGTTCGTCCTGTACAGTCCACCCCCATTCCCATGATGCCCCGGCATGTCCCACTCAGTGGTGGTGTAAGCTCTGCCTCCAGCACAAATACATCCA

TGAACTTCCCTATCAACTACTTGCAGCGGGCAGGAGTCCTTGTGCAGAAAGTGGTTACCACGACAG ATATTGTTATCCCTGGACTCAACAGCTCCACAG

ATGTTCAGGCAAGAATCAATGCTGGTGAGAGCATCCACATCATCCGAGGGACGAAAG - UNI35644 - GGACATACATCCGCACCAGTGATGGACGC

ATCTTTGCTGTCCGGGCGACCGGCAAACCAAAGGCCCCTGAAGATGGTCGGATGGCTGCCTCAG - UNI35644 - GTTCCCAGGGGCCTTCTCTTGC

GTCCACAAGCAATGGCAGACATAGTGCCTCATCACCCAAAGCCCCTGACCCCGAGGGGCTGGCCCGGCCGGTCTCTCCTGACAGCCCAGAAATCATCAGT

GAACTCCAGCAGTATGCAGATGTGGCCGCTGCTCGGGAATCCCGGCAGAGCTCCCCAAGCGTCAGTGCTGCCCTGCCTGGGCCCCCGGGCCAGCTTATGG

ACAACAGCACCATTCCTGGGACAGCTCTTGGAACTGAGCCATGCCTTGGGGGTCATTGCCTCAATAGTTCCCTCTTGGTGACTGGCCAGCCCAGTGGTGG

CAGGCACCCAGTGCTGGACTTAAGGGGCCATAAGCGAAAGTTGGCTACTCCGTCTGTCACCCAGGAATCAGTCCGTCGACGGTCCAGGAAGGGCCATCTG

CCAGCCCCCGTGCAGCCCTATGAACATGGGTATCCAGTCTCTGGCGGGTTTGCAATGCCGCCTGTCTCCTTAAATCATAACCTCACCACCCCCTTCACCT

CCCAGGCTGGGGAGAATTCCCTATTTATGGGCAGTAATCCCTCCTACTACCAGCTGTCCAATTTGCTGGCAGATGCCCGCCTGGTGTTTCCAGTGACTAC

TGACCCTCTGGTGCCAGCAGGCCCTGTCAGTTCCTCTTCCACGGCTACCTCAGTCACTGCCAGCAACCCCTCCTTCATGCTCAACCCCTCCGTGCCAGGG

ATGCTACCCAGCTATTCACTCCCATTCTCACAGCCACTCCTGTCCGAGCCCAGGATGTTTGCGCCTTTCCCTTCCCCCGGCTTGCCCAGCAACCTTTCTC

GGGGCGTGTCTGTCTACCCAGGCTATATGTCCCCACATGCAGGCTACCCAGCTGGTGGCCTCCTCCGGTCCCAGGTGCCTCCATTTGACTCGCATGAGGT

GGCGGAGGTGGGGTTCAGCTCCAATGATGATGAGGATAAAGATGATGATGTGATAGAGGTCACTGGGAAGTAGCTAGGAAGCCCCTGCCACCTCACTTGG

GGCCCCTAGGAGGTTGCCCACCAAACTGGAAGGCAATGAATCTGGTCTTTCTGAAAATAGGGTACTTGGAGGGAAAAGAAGACAAAGGAGAGTGGTTGGC

CATAATGGCAGGCTCTATTGCTGTTCATTAGAAGAAAAAAGAAAAGACCCCAGAAACTCCACAGAGCTGTAATAGTGGGAAATCAGGGACCGAAAACAGG

GATGGGGTGTGTGGCAGCCTGCCCTTCCTTCCTGTCTTTCTTCTGCTGTCTGCTTAGATGCCCATTTGAGTGTAGAAGCGCATATCCCATTCTGCCTTTG

GGAACGTCTCTCCCAAGAAATCTGCCTGAGTTACTTAGTTTGGCCTGAGGGTGGAAGAAGACTGAGGGCGGGCATGGGGAGCAGATTCCACAGGGAGGGT

ATCTCTTAGGAGGTGGGAAGGAAGTGAACCAGGCCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTA

CTCATGCATGAAAGAGAGAACATGTATGTAGCAGAACAAGGGTGAAAGTGGGAGGGCAGGGAAGGGAAAAACTAAGAGTAAACTAAAAAGAAATGAATTG

ATCTTTTTTGAAGTGTCAGTCAGAGTGTGAGGGTTTATGGCTACTGAGTTAGACATCACAGTGAGTCCAGGAGAAGAGCATGGAAGCCAGTTTCCTTCTA

GCTAGGTGAAGAGAAGGCTGGCCTAACTTAAGTCCCACATTGGTTTTTTAAGTTGGGGAAAATCATGAGAAAGTGAGTGTTTCCGATCTCTTATTCTCTC

CACAGTGGCCATCTCTGAGCAGATGTCCCTTTCCACGTGGGCACAAAGTGCACTGCAGTGTGAGGGTGAGGTGGCGTTGTGGCTGGAAAAGATGTGCTTC

ACCGGGACAGGACTGAACCCCTTCAGCTGCCTGTCTTGGTGGCCTTTCCTCTTCTTTCCCTCCCCATTAGAAAGCTCCATGTTAATTTATTTCTTATGGA

CAATTATTTATTATTTTCATTTGGGGACAAGGGTGGTGGGTGGAGGTTATAAAGAAGATAGCAGATAGTAAAGGAAGTTCTTAAATATTCCAGACCCCCA

GCTGCTGGTCAAAAACAGAAAGGGAGAGAAGGGTCCGAGGCAGATGGTGAATTAATTGACCATGGAAAGAGAATTAGAATTAACCAAAAGTTCGATTAAA

CAGCTATGTTGTGGGGAGATGGCCTCTCAGGAAAATCAGGGTGCCCTGAGACTGGCTAGTTGGGGGTGGTGAGACTCATTCCATAGAAACTGAAACTTGG

GATCATGGACTTTGCTACTGGGAAGTAAGTAACCTCCACATTTGGAACTATTGTCCTCTGATGATTTCACAGGCCAGTTCTCTGCTGAAAAGTGAAGCTG

TGGGTAGGTAGCCTGGGTTGAGGTAATAGACTGTTGATTTTGAGTTGGGGCTTGTCTTGGCCTCCCTAGCATTTCAGGTGATCAGTATGGGCCTGGTTTC

TGGTCCCTCCATTTCTCTAAGTATCACAGGGAAGCCCTTCCTCTGTAGGAGTCTTACGTCTGGCTTTTTTTTTTTTTTTAAAGAGTACGAACACGAGTCA

TTCTGGTCTCCCTTCCTTTGTTTCAAATACCACGGCAGGGGTGTCTAGTGCTTAAACATAAACACTGGCTGTTTTCTATTACTGGTGTGTCCTGCGTCCT

ATAGCCCTCTGTCTCCCAAGCTTTTCCATGCAGCCCTTTGATTAATAACTCCTGTCTGGCTTTACCTCCTTCCCTTGGCTCCAACCTGGTTGGGCAATGG

CTAGATCTGCCTCCTAGTCCAAAAGTATCTTAAGCACTGCCTGTGACTCTTGACTAGCGACTTCTCATTGTTAGGGGGAAAGGAGGGAGCTTAAAGGCAG

ACACTGGGATTGTCCCAGAGACAAGGAGAGAGATGGTTGATGGGGTGTGTGTACTGTCCAGTAACACCAAAGTGGACTTGTGCTTTCTCTGTTTTCATGT

GCACCCTGTCAGACTTAACTCTTCTACTCATAGAAGCCTTAGATCTACAATTTAGCTATGCAAATTATCTGTAACAATTTAAAAATAGCAGTTTCAACCA

GTGCTTTCTCAGTCAAATGTAGTCCAAGAATCGATAGTCAAGGCATTTAATTGGCGTGGGTTCTGAGGTTGGGGCTGGTACAGTGGGAGCGAGCGAGTCC

AGATCTCTATAACTTGTAGAACGCATTCAGAGCTTGGGTTACATGGATGTCCCTCAGACCTCGGAACACTGAGCTCCCAGAGTTGTCTCTGTTACATGGA

CTCCTCTCAGACATTGGAATACTGAGTTCCCAGAGTTGTATGTCTGTGTGTATGCCCTGCTAGCCAGGAAGAGGGCTGTTTCTGTGTTCACAAATAGTAA

ATTAGTAGAAACAATTTCAGTAGGGAACTGGAACTGGTTTTTAAGCAGCCAGGAAGTAAATGGGAATTCTGAGAGGAACACGTGACTGCTGTACACTCCA

GCAGTCATCCTGGGCTTGGAGCGTACTTCATCTTTGCAGCAGCCATAACTCTAGACAGGCCTCCTGGCTAAAGGTTTCTCTGTGATAACATGCAGCTTAT

GTTGTATAAGGGTGGGGGTGAGATCATAGGAGATTGAATTGCTTACTAGCTCCATGGGCTTTGGCAACTCCCCTCCCTCCAACAACCCTAAATATCCTGC

TTTTCAAATGGACTTATGGGGAAGTGTGCATGCGCACCAAGCATGAGCATGTGCTGAGGGAAGCAGGAACCTCACAATCTATTGTGCTTAGATTGGAAAC

CCGAGGTGGTAGTGGGTATACCAGCTATGCTTGTAATCCTAGCCCTCAAGAAACTGAAGCAGGAAGACCATTTTGGGCTATGTATACAGTGAGACCATGT

CTTTCATGGAATGTTTTAAGGGTCTCAAGAAGCCCAGTCACTCTGGTGTATTCTAAATCCCTGTTCTCTTTAACACTACTAAATGATGCAGATACTTGCT

ACCTTAGGTCTGCTGTGTCCCCTCTGGGAGGGATGGGGTAGCTATTGAAGAAAGTAAGTGAACCACATTAGGTCAGAGCCTTCTTAATGGCTTATCTCTT

TAGTCCTTACCCCTTGAGTAACGCTACTTAAGTATCTGTATTCCTGGCTTAAAGATTTTGTCTGGAACTCTTGTAGGAATTAATGTGTGGATCATATATT

TATAACTTACAACTAAAACTGAAGTTTCCCACTCTGGGAGCGTGAAGCAAGGAGCTGGGGTCTGTTTTGCTGATTAGTTGAAACAGAAGATCAACCATAG

AGGTGGGACTGCAAGTCGCAGGCAGTCAGTATCTTTAGGTGTGACATCCATGGCTCTGGAACTGAGTCCTTGTCTACAGGGGAAGGTTTTTCTGGGGCGT

TACATTCCTTGTTCCTACACAGACCTTTTGTTTCCCACTTCCCTTTGCTTTCCACATGCCCAGGTCTGAACCATGGTTTTCTGTGCACTCTCAGCTAGGT

TGCTCTTTCCCAGTATTACTGCTGGGAGAAGTCCCCTTCCCCGAGGATGACTTTCTGGCTCCACTGCTGACTAGTTCCCAGGAAATCAGCACCTTAAACG

GCCAATCTGCCAAGTGCTGACCTGCCCACTGCTCACCTTCAGACCCTTCTGCCCCTGTGTATCCAAATCGGTGTAATCCCTCAACGTCTGTTCTGTGCCA

CTAGCTTGGCTTTAAGCCGTTTATGAATACGTGAGTCCTATGATGATGAACTAATACGCAGGCAGTGTCCACCCTCTTTGCTTTTCAGGGACCCAAGTCT

GCGCCTTTCCCCTGCCATGAGTCTGTTTGCTATAGTCATCTAGTGTGCTGGGGAGAGAGAGCCAGGCAGGCTGCATAGTAATCTACAATGTAGAGGGCTG

AGGGAGGTTTGGGCACTCTCTACTACCACTACTAGGATGATATTCAGACAAGAGAGGACCTCATACTGTGACCTGAACCCAGGACCCTCCCTGGAAGAGA

GCTCAGCCCAGCTGTGTTTGAGTGAATGTGTGTATGTGTTTGCATGTGTGTGCTCATGTGCACTGTGGTGTAAAATGACTGTTATCTGGTTGTAACTCAG

GGCAGGCTGGGGACTCACCAGAAGATTCCTTCAGGCCTGCCCGAAACAGATTTTTTTCCTTGTACCCTCTTCAGAGGGATCAGAGAGAGGGTCCAGGTGG

GTTGAAGGGGTTGCAACAGATAACCACTAAGGCCACACTGCTGCCAGAGGAGTTGGGGGGGAGGGGGAGGGAGATGAGGCTGCCCCAAGGCTCTGGTACC

TGGCTTTAGTTTTCTGTCTTCTTTCCTCAGGATGCCCCTGAGGCCCAGGACCTGTGCCTGGCTTAGAGGACCATCTGTGGCTGGGTGGTCCAGCTGCTGG

TGTGATCATGGGCTTCCCTCCTCTCTCAGCAGGGCAGACACGTCTGCTCCAGGGACTGGGCGACTGGCTGTTTCTATGACGTATTTATTTTTACTTGTGT

TTCATGTCACTTTTTTAAAAAAAAAAAGCAAACAGAACAATTGTAAGTCAGTATAACTGCCTATCAGTTTTCTTTATTTCTCTTTTTGTAAAATAAAGTT

TAAACTC
Translation
 - UNI7391 - MSDESASGSDPDLDPDVELEDEEEEEEEEEEVAVEEHDRDDEEGLLDD - UNI5981 - DTSLEGMCGTEHAQLGEDGQRPPRCT

STTSSQSEPSEQLRHQGKILASEDPKKKRAQKPSHMRRNIR RKLLREDQLEPVTKAAQQEELERRKRLEQQRKEYAAPIPTVPLEFLPE EEIVLRASD

GPQLPPRVLAQEVICLDSSSGSEDEKSSRDE EVIELSSGEEDTLHIVDSSESVSEEDEEEEKGGTHVNDALNQHDALGRVLVNLNHPPEEENVFLAPQL

ARAVKPHQ IGGIRFLYDNLVESLERFKTSSGFGCILAHSMGLGKTLQVISFIDVLFRHTPAKTVLAIVP VNTLQNWLAEFNMWLPAPEALPADSKPEE

VQPRFFKVHILNDEHK KTVASRAKVTADWVSEGGVLLMGYEMYRLLTLKKSLATSRPKKTKKRSHPVIIDLDEEDRQQEFRRE EFEKALCRPGPDVVI

CDEGHRIKNCQASTSQALKNIRSRRRVVLTGYPLQNNLIEYWCMVDFVRPDFLGTRQEFSNMFERPILNGQCIDSTPQDVRLMRYRSHVLHSLLEGFVQR

 RRGHTVLKIHLPAKEENVILVRLSQIQRDLYTQFMDRFRDCGTSGWLGLNPLKAFCVCCK IWNHPDVLYEALQKENLANEQDLDVEELGSAGTSARCP

PHGTKVKGEDSALPSSMGEATNSKFLQGVGFNPFQERGNNIVTYEW AKELLTNYQTGVLENSPKMVLLFHLIEESVKLGDKILVFS SQSLSTLALIEE

FLGKRDMPCLPGAEGQGTQKWVRNVSYFR RLDGSTPAFERERLINQFNDPSNLTTWLFLLSTR RAGCLGVNLIGANRVVVFDASWNPCHDAQAVCRVY

RYGQKKPCHIYRLVADYTLEKKIYDRQISKQGMSD DRVVDDLNPMLNFTRKEVENLLHFVEKEPAPQTSLDIKGIKESVLQLACLKYPHLITK - UNI

1892 - EPFEHESLLLNRKDHKLTKAEKKAAKKSYEEDKRTSVPYTRPSYAQYYPASDQSLTSIPAFSQRNW WQPTLKGDEKPVASVRPVQSTPIPMM

PRHVPLSGGVSSASSTNTSMNFPINYLQRAGVLVQKVVTTTD DIVIPGLNSSTDVQARINAGESIHIIRGTKG - UNI35644 - GTYIRTSDGRIF

AVRATGKPKAPEDGRMAASG - UNI35644 - GSQGPSLASTSNGRHSASSPKAPDPEGLARPVSPDSPEIISELQQYADVAAARESRQSSPSVSAAL

PGPPGQLMDNSTIPGTALGTEPCLGGHCLNSSLLVTGQPSGGRHPVLDLRGHKRKLATPSVTQESVRRRSRKGHLPAPVQPYEHGYPVSGGFAMPPVSLN

HNLTTPFTSQAGENSLFMGSNPSYYQLSNLLADARLVFPVTTDPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGMLPSYSLPFSQPLLSEPRMFAPFPS

PGLPSNLSRGVSVYPGYMSPHAGYPAGGLLRSQVPPFDSHEVAEVGFSSNDDEDKDDDVIEVTGK

For any suggestions or comments, please send an email to unitrap@crg.es