Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040667 (Nup88)
Chromosomal location
Chr 11: 70756574 - 70783475 (-)
Description
nucleoporin 88 Gene [Source:MGI (curated);Acc:Nup88-001]
RefSeq_dna
NM_001083331 NM_172394 
RefSeq_peptide
NP_001076800.1 NP_765982.2 
MGI
MGI:104900 
Uniprot/SWISSPROT
Q8CEC0 
Uniprot/SPTREMBL
Q3U9L4 Q5QNT9 Q8BQF0 Q8CAD9 Q3TM09 Q5QNU1 Q5QNU0 
Human Ortholog
ENSG00000108559 (NUP88)
Omim not available
UniTrap UNI19080
Vector Insertion
Chr 11: 70783150 - 70783457
Public Clones not available
Private Clones OST405341 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32500
Vector Insertion
Chr 11: 70781349 - 70783457
Public Clones (sanger) IST14912D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11593
Vector Insertion
Chr 11: 70775171 - 70779208
Public Clones (sanger) W248A04 (ggtc) W247A05 (ggtc) P064C11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11943
Vector Insertion
Chr 11: 70771942 - 70775083
Public Clones (sanger) W247C05 (ggtc) E130G08 (ggtc) Q011E07 (ggtc) E026B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38594
Vector Insertion
Chr 11: 70769637 - 70771942
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9564
Vector Insertion
Chr 11: 70764861 - 70768002
Public Clones XE495 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035283
Sequence
AATCCTGAGCTGTTAGTTCAAGATGGCGGCTGCCGTGGGGCCCTTGGGCGATGGGGAGCTGTGGCAGAGCTGGCTTCCTAACCACGTCGTGTTCTTGCGG

CTCCGCGAGGGCGTAAGAAACCAGAGTCCAGCCGAAGCGGAGAAGCCAGCGGCTTCGACTTCACCCTCGTGCCCGTCTCTGCCGCCGCATTTGCCGACGA

GAAACCTGGTCTTCGGCCTCGGAGGGGAACTGTTTCTGTGGGACGCAGAAGGCAGCGCCTTCTTGGTGGTTCGCCTTCGAGGCCCCAGCGGTGGTGGCGT

GGAGCCTCCTCTCTCCCAGTATCAG - UNI19080 - - UNI32500 - AGATTACTCTGCATTAATCCACCCTTGTTTGAAATCCATCAAGTCTTG

TTGAGTCCAACCCAACATCATGTAGCACTTATCGGAAGTAAAGGACTTATGGCATTAGAATTACCTCAGAGGTGGGGGAAGGACTCTGAATTTGAAGGTG

GAAAAGCAACTGTGAATTGTAG - UNI32500 - CACCATCCCGATTGCTGAGAGATTTTTCACCAGCTCTACCTCTCTGACTCTGAAGCATGCTGCA

TGGTATCCAAGTGAGATGCTGGATCCCCACATAGTGCTGTTGACATCAGACAACGTGATAAG - UNI11593 - AATTTATTCTCTCCGTGAGCCCCA

GACACCCACTAAGGTGATTGTACTTTCAGAAGCAGAAGAGGAAAGTTTAATACTCAATAAAGG - UNI11943 - AAGAGCATATACAGCGTCTCTAG

GAGAGACTGCAGTGGCGTTTGACTTCGGGCCCCTGGTAACCGTCTCAAAGAATATATTTGAACAGAAAGACAGAGATGTGGTGGCGTATCCACTGTACAT

CCTGTATGAGAATGGGGAGACCTTCCTTACCTACGTGAGCCTGTTACACAG CCCAGGGAATATTGGGAAGCTGTTGGGCCCACTGCCTATGCATCCTGC

AGCTGAAGATAACTACGGTTACGATGCCTGTGCTATACTCTGTTTGCCCTGTGTTCCAAATATCTTAGTAATTGCGACTGAGTCAGGAATGCTGTACCAC

TGTGTTGTACTAGAGGGAGAAGAAGAAGATGACCAAACG TTAGAAAAGTCCTGGGATCCCAGGGCTGACTTCATCCCTTCTCTGTACGTGTTTGAGTGT

GTTGAGTTAGAGCTTGCCCTGAAGCTGGCATCTGGAGAGGACGATCCCTTTGCCTCTGACTTTTCCTGCCCAATTAAACTGCACAGAG - UNI9564 -

 ATCCCAAGTGTCCTTCGAGATACCACTGCAGCCATGAAGCTGGCGTGCACAGTGTGGGGCTGACTTGGATTCACAAACTGCACAAATTTCTTGGATCGG

 ATGAAGAAGATAAGGATAGTTTACAAGAACTCACTGCTGAGCAGAAATGCTTTGTGGAGCACATTCTTTGTACAAAGCCATTGCCGTGCAG GCAGCCA

GCTCCAATTCGAGGATTCTGGATCGTCCCAGACATCCTGGGGCCCACAATGATCTGCATCACCAGTACCTATGAATGTCTCATACGGCCTTTATT AAGT

ACAGTCCACCCAGCATCTCCTCCCCTGCTCTGTACCCAAGAAGATGCTGAAGTTGCAGAGTCTCCACTGCGCATTCTGGCTGAAACTCCAGACTCCTTTG

AGAAGCATATTAAAAGAATCTTGCAGCGTAGTGCTGCCAACCCAGCATTTCTCAA AAACTGTTCTGCAAGATCATCTGAAAAGGATTTGGCTCCCCCTC

CCGAGGAGTGTCTTCAGCTTATCAGCAGAGCCACCCAGGTGTTCCGAGAACAGTACATTCTCAAGCAGGACCTGGCCAAGGAGGAGATTCAGCGGAG GG

TCAAATTATTATGTGACCAAAAGAGGAAACAACTCGAAGATCTCAATTACTGTCGAGAGGAAAG GGTTTCTCATCTCTTCAGGAAAAGTCTCCGGGAAA

TGGCTGAGCGCTTAGCTGACAAATATGAGGAAGCCAAAGAAAAACAAGAAGATATCATGAACAG GATGAAAAAAGTGCTTCACAGTTTTCATGCTCAGC

TCCCAGTTCTCTCTGACAGTGAGAGAGACATGAAGAAAGAGTTACAGCTGATACCTGATCAACTGCGACATCTAGGCAACGCCATCAAACAG GTTACTA

TGAAAAAAGATTATCAACAGCGGAAGATGGAAAAAGTGCTGAGTCCTCAGAAACCCACCATTACTCTCAGTGCCTACCAGCGAAAGTGCATTCAGTCCAT

CCTGAAAGAAGA GGGTGAACACATAAGGGAAATGGTGAAGCAAATCAATGACATCCGAAATCATGTCACCTTCTGACACCACCTGGAATGAACATAACT

TGAAGGCTGTAAAACAAACAGGGAGCACTGTTTAATTTATAAAGGAGCATTTTGGATAAGATTTGGTGTGGTTATTCTTTTGTTATTCCTTTTTGTTATT

ATTTCTGTTAAATAAATTTATTTATTCAAATAAAGTTTGAATAAATTTTTATTC
Translation
MAAAVGPLGDGELWQSWLPNHVVFLRLREGVRNQSPAEAEKPAASTSPSCPSLPPHLPTRNLVFGLGGELFLWDAEGSAFLVVRLRGPSGGGVEPPLSQY

Q - UNI19080 - - UNI32500 - RLLCINPPLFEIHQVLLSPTQHHVALIGSKGLMALELPQRWGKDSEFEGGKATVNCS - UNI32500 - S

TIPIAERFFTSSTSLTLKHAAWYPSEMLDPHIVLLTSDNVIR - UNI11593 - RIYSLREPQTPTKVIVLSEAEEESLILNKG - UNI11943 - 

GRAYTASLGETAVAFDFGPLVTVSKNIFEQKDRDVVAYPLYILYENGETFLTYVSLLHS SPGNIGKLLGPLPMHPAAEDNYGYDACAILCLPCVPNILV

IATESGMLYHCVVLEGEEEDDQT LEKSWDPRADFIPSLYVFECVELELALKLASGEDDPFASDFSCPIKLHRD - UNI9564 - DPKCPSRYHCSHE

AGVHSVGLTWIHKLHKFLGSD DEEDKDSLQELTAEQKCFVEHILCTKPLPCR RQPAPIRGFWIVPDILGPTMICITSTYECLIRPLL LSTVHPASPP

LLCTQEDAEVAESPLRILAETPDSFEKHIKRILQRSAANPAFLK KNCSARSSEKDLAPPPEECLQLISRATQVFREQYILKQDLAKEEIQRR RVKLLC

DQKRKQLEDLNYCREER RVSHLFRKSLREMAERLADKYEEAKEKQEDIMNR RMKKVLHSFHAQLPVLSDSERDMKKELQLIPDQLRHLGNAIKQ VTM

KKDYQQRKMEKVLSPQKPTITLSAYQRKCIQSILKEE EGEHIREMVKQINDIRNHVTF
Transcript ENSMUST00000108531
Sequence
AATCCTGAGCTGTTAGTTCAAGATGGCGGCTGCCGTGGGGCCCTTGGGCGATGGGGAGCTGTGGCAGAGCTGGCTTCCTAACCACGTCGTGTTCTTGCGG

CTCCGCGAGGGCGTAAGAAACCAGAGTCCAGCCGAAGCGGAGAAGCCAGCGGCTTCGACTTCACCCTCGTGCCCGTCTCTGCCGCCGCATTTGCCGACGA

GAAACCTGGTCTTCGGCCTCGGAGGGGAACTGTTTCTGTGGGACGCAGAAGGCAGCGCCTTCTTGGTGGTTCGCCTTCGAGGCCCCAGCGGTGGTGGCGT

GGAGCCTCCTCTCTCCCAGTATCAG - UNI19080 - - UNI32500 - AGATTACTCTGCATTAATCCACCCTTGTTTGAAATCCATCAAGTCTTG

TTGAGTCCAACCCAACATCATGTAGCACTTATCGGAAGTAAAGGACTTATGGCATTAGAATTACCTCAGAGGTGGGGGAAGGACTCTGAATTTGAAGGTG

GAAAAGCAACTGTGAATTGTAG - UNI32500 - CACCATCCCGATTGCTGAGAGATTTTTCACCAGCTCTACCTCTCTGACTCTGAAGCATGCTGCA

TGGTATCCAAGTGAGATGCTGGATCCCCACATAGTGCTGTTGACATCAGACAACGTGATAAG - UNI11593 - AATTTATTCTCTCCGTGAGCCCCA

GACACCCACTAAGGTGATTGTACTTTCAGAAGCAGAAGAGGAAAGTTTAATACTCAATAAAGG - UNI11943 - AAGAGCATATACAGCGTCTCTAG

GAGAGACTGCAGTGGCGTTTGACTTCGGGCCCCTGGTAACCGTCTCAAAGAATATATTTGAACAGAAAGACAGAGATGTGGTGGCGTATCCACTGTACAT

CCTGTATGAGAATGGGGAGACCTTCCTTACCTACGTGAGCCTGTTACACAG CCCAGGGAATATTGGGAAGCTGTTGGGCCCACTGCCTATGCATCCTGC

AGCTGAAGATAACTACGGTTACGATGCCTGTGCTATACTCTGTTTGCCCTGTGTTCCAAATATCTTAGTAATTGCGACTGAGTCAGGAATGCTGTACCAC

TGTGTTGTACTAGAGGGAGAAGAAGAAGATGACCAAACG TTAGAAAAGTCCTGGGATCCCAGGGCTGACTTCATCCCTTCTCTGTACGTGTTTGAGTGT

GTTGAGTTAGAGCTTGCCCTGAAGCTGGCATCTGGAGAGGACGATCCCTTTGCCTCTGACTTTTCCTGCCCAATTAAACTGCACAGAG - UNI9564 -

 ATCCCAAGTGTCCTTCGAGATACCACTGCAGCCATGAAGCTGGCGTGCACAGTGTGGGGCTGACTTGGATTCACAAACTGCACAAATTTCTTGGATCGG

 ATGAAGAAGATAAGGATAGTTTACAAGAACTCACTGCTGAGCAGAAATGCTTTGTGGAGCACATTCTTTGTACAAAGCCATTGCCGTGCAG GCAGCCA

GCTCCAATTCGAGGATTCTGGATCGTCCCAGACATCCTGGGGCCCACAATGATCTGCATCACCAGTACCTATGAATGTCTCATACGGCCTTTATT AAGT

ACAGTCCACCCAGCATCTCCTCCCCTGCTCTGTACCCAAGAAGATGCTGAAGTTGCAGAGTCTCCACTGCGCATTCTGGCTGAAACTCCAGACTCCTTTG

AGAAGCATATTAAAAGAATCTTGCAGCGTAGTGCTGCCAACCCAGCATTTCTCAA AAACTGTTCTGCAAGATCATCTGAAAAGGATTTGGCTCCCCCTC

CCGAGGAGTGTCTTCAGCTTATCAGCAGAGCCACCCAGGTGTTCCGAGAACAGTACATTCTCAAGCAGGACCTGGCCAAGGAGGAGATTCAGCGGAG GG

TCAAATTATTATGTGACCAAAAGAGGAAACAACTCGAAGATCTCAATTACTGTCGAGAGGAAAG GAAAAGTCTCCGGGAAATGGCTGAGCGCTTAGCTG

ACAAATATGAGGAAGCCAAAGAAAAACAAGAAGATATCATGAACAG GATGAAAAAAGTGCTTCACAGTTTTCATGCTCAGCTCCCAGTTCTCTCTGACA

GTGAGAGAGACATGAAGAAAGAGTTACAGCTGATACCTGATCAACTGCGACATCTAGGCAACGCCATCAAACAG GTTACTATGAAAAAAGATTATCAAC

AGCGGAAGATGGAAAAAGTGCTGAGTCCTCAGAAACCCACCATTACTCTCAGTGCCTACCAGCGAAAGTGCATTCAGTCCATCCTGAAAGAAGA GGGTG

AACACATAAGGGAAATGGTGAAGCAAATCAATGACATCCGAAATCATGTCACCTTCTGACACCACCTGGAATGAACATAACTTGAAGGCTGTAAAACAAA

CAGGGAGCACTGTTTAATTTATAAAGGAGCATTTTGGATAAGATTTGGTGTGGTTATTCTTTTGTTATTCCTTTTTGTTATTATTTCTGTTAAATAAATT

TATTTATTCAAATAAAGTTTGAATAAATTTTTATTCAAAAATTTGA
Translation
MAAAVGPLGDGELWQSWLPNHVVFLRLREGVRNQSPAEAEKPAASTSPSCPSLPPHLPTRNLVFGLGGELFLWDAEGSAFLVVRLRGPSGGGVEPPLSQY

Q - UNI19080 - - UNI32500 - RLLCINPPLFEIHQVLLSPTQHHVALIGSKGLMALELPQRWGKDSEFEGGKATVNCS - UNI32500 - S

TIPIAERFFTSSTSLTLKHAAWYPSEMLDPHIVLLTSDNVIR - UNI11593 - RIYSLREPQTPTKVIVLSEAEEESLILNKG - UNI11943 - 

GRAYTASLGETAVAFDFGPLVTVSKNIFEQKDRDVVAYPLYILYENGETFLTYVSLLHS SPGNIGKLLGPLPMHPAAEDNYGYDACAILCLPCVPNILV

IATESGMLYHCVVLEGEEEDDQT LEKSWDPRADFIPSLYVFECVELELALKLASGEDDPFASDFSCPIKLHRD - UNI9564 - DPKCPSRYHCSHE

AGVHSVGLTWIHKLHKFLGSD DEEDKDSLQELTAEQKCFVEHILCTKPLPCR RQPAPIRGFWIVPDILGPTMICITSTYECLIRPLL LSTVHPASPP

LLCTQEDAEVAESPLRILAETPDSFEKHIKRILQRSAANPAFLK KNCSARSSEKDLAPPPEECLQLISRATQVFREQYILKQDLAKEEIQRR RVKLLC

DQKRKQLEDLNYCREER RKSLREMAERLADKYEEAKEKQEDIMNR RMKKVLHSFHAQLPVLSDSERDMKKELQLIPDQLRHLGNAIKQ VTMKKDYQQ

RKMEKVLSPQKPTITLSAYQRKCIQSILKEE EGEHIREMVKQINDIRNHVTF
Transcript ENSMUST00000108530
Sequence
AAGATGGCGGCTGCCGTGGGGCCCTTGGGCGATGGGGAGCTGTGGCAGAGCTGGCTTCCTAACCACGTCGTGTTCTTGCGGCTCCGCGAGGGCGTAAGAA

ACCAGAGTCCAGCCGAAGCGGAGAAGCCAGCGGCTTCGACTTCACCCTCGTGCCCGTCTCTGCCGCCGCATTTGCCGACGAGAAACCTGGTCTTCGGCCT

CGGAGGGGAACTGTTTCTGTGGGACGCAGAAGGCAGCGCCTTCTTGGTGGTTCGCCTTCGAGGCCCCAGCGGTGGTGGCGTGGAGCCTCCTCTCTCCCAG

TATCAG - UNI19080 - - UNI32500 - AGATTACTCTGCATTAATCCACCCTTGTTTGAAATCCATCAAGTCTTGTTGAGTCCAACCCAACATC

ATGTAGCACTTATCGGAAGTAAAGGACTTATGGCATTAGAATTACCTCAGAGGTGGGGGAAGGACTCTGAATTTGAAGGTGGAAAAGCAACTGTGAATTG

TAG - UNI32500 - CACCATCCCGATTGCTGAGAGATTTTTCACCAGCTCTACCTCTCTGACTCTGAAGCATGCTGCATGGTATCCAAGTGAGATGC

TGGATCCCCACATAGTGCTGTTGACATCAGACAACGTGATAAG - UNI11593 - AATTTATTCTCTCCGTGAGCCCCAGACACCCACTAAGGTGATT

GTACTTTCAGAAGCAGAAGAGGAAAGTTTAATACTCAATAAAGG - UNI11943 - AAGAGCATATACAGCGTCTCTAGGAGAGACTGCAGTGGCGTT

TGACTTCGGGCCCCTGGTAACCGTCTCAAAGAATATATTTGAACAGAAAGACAGAGATGTGGTGGCGTATCCACTGTACATCCTGTATGAGAATGGGGAG

ACCTTCCTTACCTACGTGAGCCTGTTACACAG CCCAGGGAATATTGGGAAGCTGTTGGGCCCACTGCCTATGCATCCTGCAGCTGAAGATAACTACGGT

TACGATGCCTGTGCTATACTCTGTTTGCCCTGTGTTCCAAATATCTTAGTAATTGCGACTGAGTCAGGAATGCTGTACCACTGTGTTGTACTAGAGGGAG

AAGAAGAAGATGACCAAACG TTAGAAAAGTCCTGGGATCCCAGGGCTGACTTCATCCCTTCTCTGTACGTGTTTGAGTGTGTTGAGTTAGAGCTTGCCC

TGAAGCTGGCATCTGGAGAGGACGATCCCTTTGCCTCTGACTTTTCCTGCCCAATTAAACTGCACAGAG - UNI9564 - ATCCCAAGTGTCCTTCGA

GATACCACTGCAGCCATGAAGCTGGCGTGCACAGTGTGGGGCTGACTTGGATTCACAAACTGCACAAATTTCTTGGATCGG ATGAAGAAGATAAGGATA

GTTTACAAGAACTCACTGCTGAGCAGAAATGCTTTGTGGAGCACATTCTTTGTACAAAGCCATTGCCGTGCAG GCAGCCAGCTCCAATTCGAGGATTCT

GGATCGTCCCAGACATCCTGGGGCCCACAATGATCTGCATCACCAGTACCTATGAATGTCTCATACGGCCTTTATT AAGTACAGTCCACCCAGCATCTC

CTCCCCTGCTCTGTACCCAAGAAGATGCTGAAGTTGCAGAGTCTCCACTGCGCATTCTGGCTGAAACTCCAGACTCCTTTGAGAAGCATATTAAAAGAAT

CTTGCAGCGTAGTGCTGCCAACCCAGCATTTCTCAA ATCATCTGAAAAGGATTTGGCTCCCCCTCCCGAGGAGTGTCTTCAGCTTATCAGCAGAGCCAC

CCAGGTGTTCCGAGAACAGTACATTCTCAAGCAGGACCTGGCCAAGGAGGAGATTCAGCGGAG GGTCAAATTATTATGTGACCAAAAGAGGAAACAACT

CGAAGATCTCAATTACTGTCGAGAGGAAAG GAAAAGTCTCCGGGAAATGGCTGAGCGCTTAGCTGACAAATATGAGGAAGCCAAAGAAAAACAAGAAGA

TATCATGAACAG GATGAAAAAAGTGCTTCACAGTTTTCATGCTCAGCTCCCAGTTCTCTCTGACAGTGAGAGAGACATGAAGAAAGAGTTACAGCTGAT

ACCTGATCAACTGCGACATCTAGGCAACGCCATCAAACAG GTTACTATGAAAAAAGATTATCAACAGCGGAAGATGGAAAAAGTGCTGAGTCCTCAGAA

ACCCACCATTACTCTCAGTGCCTACCAGCGAAAGTGCATTCAGTCCATCCTGAAAGAAGA GGGTGAACACATAAGGGAAATGGTGAAGCAAATCAATGA

CATCCGAAATCATGTCACCTTCTGACACCACCTGGAATGAACATAACTTGAAGGCTGTAAAACAAACAGGGAGCACTGTTTAATTTATAAAGGAGCATTT

TGGATAAGATTTGGTGTGGTTATTCTTTTGTTATTCCTTTTTGTTATTATTTCTGTTAAATAAATTTATTTATTCAAATAAA
Translation
MAAAVGPLGDGELWQSWLPNHVVFLRLREGVRNQSPAEAEKPAASTSPSCPSLPPHLPTRNLVFGLGGELFLWDAEGSAFLVVRLRGPSGGGVEPPLSQY

Q - UNI19080 - - UNI32500 - RLLCINPPLFEIHQVLLSPTQHHVALIGSKGLMALELPQRWGKDSEFEGGKATVNCS - UNI32500 - S

TIPIAERFFTSSTSLTLKHAAWYPSEMLDPHIVLLTSDNVIR - UNI11593 - RIYSLREPQTPTKVIVLSEAEEESLILNKG - UNI11943 - 

GRAYTASLGETAVAFDFGPLVTVSKNIFEQKDRDVVAYPLYILYENGETFLTYVSLLHS SPGNIGKLLGPLPMHPAAEDNYGYDACAILCLPCVPNILV

IATESGMLYHCVVLEGEEEDDQT LEKSWDPRADFIPSLYVFECVELELALKLASGEDDPFASDFSCPIKLHRD - UNI9564 - DPKCPSRYHCSHE

AGVHSVGLTWIHKLHKFLGSD DEEDKDSLQELTAEQKCFVEHILCTKPLPCR RQPAPIRGFWIVPDILGPTMICITSTYECLIRPLL LSTVHPASPP

LLCTQEDAEVAESPLRILAETPDSFEKHIKRILQRSAANPAFLK KSSEKDLAPPPEECLQLISRATQVFREQYILKQDLAKEEIQRR RVKLLCDQKRK

QLEDLNYCREER RKSLREMAERLADKYEEAKEKQEDIMNR RMKKVLHSFHAQLPVLSDSERDMKKELQLIPDQLRHLGNAIKQ VTMKKDYQQRKMEK

VLSPQKPTITLSAYQRKCIQSILKEE EGEHIREMVKQINDIRNHVTF

For any suggestions or comments, please send an email to unitrap@crg.es