Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040675 (Mthfd1l)
Chromosomal location
Chr 10: 6179460 - 6373428 (-)
Description
methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like Gene [Source:MGI (curated);Acc:Mthfd1l-003]
RefSeq_dna
NM_172308 
RefSeq_peptide
NP_758512.2 
UniGene
Mm.398903 Mm.184752 
MGI
MGI:1924836 
Uniprot/SWISSPROT
Q3V3R1 
Human Ortholog
ENSG00000176134 (AL591379.18)
Omim not available
UniTrap UNI10625
Vector Insertion
Chr 10: 6367908 - 6373062
Public Clones G077G02 (ggtc) M090F07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34112
Vector Insertion
Chr 10: 6338687 - 6356681
Public Clones IST14885E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11099
Vector Insertion
Chr 10: 6298342 - 6298569
Public Clones G072E04 (ggtc) G062E01 (ggtc) G054G11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11070
Vector Insertion
Chr 10: 6289792 - 6298272
Public Clones G005G01 (ggtc) G055F03 (ggtc) G063B11 (ggtc) G064B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11091
Vector Insertion
Chr 10: 6262805 - 6289679
Public Clones (sanger) G069H06 (ggtc) G056A07 (ggtc) G005C06 (ggtc) G054F10 (ggtc)
E122A07 (ggtc) G056E06 (ggtc) IST14686B1 (tigm)
Private Clones OST432910 (lexicon) OST197624 (lexicon) OST173277 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27978
Vector Insertion
Chr 10: 6258308 - 6262664
Public Clones not available
Private Clones OST43063 (lexicon) OST36731 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20858
Vector Insertion
Chr 10: 6257247 - 6258265
Public Clones not available
Private Clones OST349593 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10586
Vector Insertion
Chr 10: 6243306 - 6256367
Public Clones G063C04 (ggtc) G048H06 (ggtc) P083D11 (ggtc) G049H06 (ggtc) G063G04 (ggtc)
CMHD-GT_318E04-3 (cmhd)
Private Clones OST180167 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10947
Vector Insertion
Chr 10: 6240165 - 6243197
Public Clones (sanger) G040C09 (ggtc) P073G02 (ggtc) P086H03 (ggtc) IST10512E9HMF1 (tigm)
IST14766D6 (tigm) IST12388G2 (tigm) IST10512E9 (tigm)
Private Clones OST426438 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI663
Vector Insertion
Chr 10: 6198533 - 6240011
Public Clones (sanger) DC0431 (sanger) E103G05 (ggtc) E132E02 (ggtc) E118A12 (ggtc)
CMHD-GT_258F3-3 (cmhd) CMHD-GT_442B7-3 (cmhd) CMHD-GT_181C10-3 (cmhd) CMHD-GT_423D8-3 (cmhd)
CMHD-GT_543G9-5S (cmhd) CMHD-GT_350D4-3 (cmhd) CMHD-GT_512.1E9-3 (cmhd) CMHD-GT_253C3-3 (cmhd)
CMHD-GT_433G10-3 (cmhd) CMHD-GT_156C1-3 (cmhd) CMHD-GT_509D12-3 (cmhd) CMHD-GT_280A10-3 (cmhd)
CMHD-GT_466F6-3 (cmhd) CMHD-GT_176C5-3 (cmhd) CMHD-GT_433A9-3 (cmhd) CMHD-GT_139E6-3 (cmhd)
CMHD-GT_541D1-3 (cmhd) IST11008F11 (tigm) IST13073G5 (tigm) IST12008E11 (tigm)
IST11823A4HMF2 (tigm) IST13049G4 (tigm) IST10197D7 (tigm) IST14781C11 (tigm)
Private Clones OST452301 (lexicon) OST436386 (lexicon) OST432880 (lexicon) OST393752 (lexicon)
OST381662 (lexicon) OST372669 (lexicon) OST368035 (lexicon) OST367116 (lexicon)
OST342270 (lexicon) OST291504 (lexicon) OST282321 (lexicon) OST278408 (lexicon)
OST246626 (lexicon) OST188666 (lexicon) OST126706 (lexicon) OST100483 (lexicon)
OST87285 (lexicon) OST85756 (lexicon) OST71899 (lexicon) OST68881 (lexicon)
OST60666 (lexicon) OST55613 (lexicon) OST34893 (lexicon) OST28858 (lexicon)
OST20371 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13940
Vector Insertion
Chr 10: 6191000 - 6198414
Public Clones CMHD-GT_122.1H8-3 (cmhd) CMHD-GT_543G9-3 (cmhd) CMHD-GT_163E9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30365
Vector Insertion
Chr 10: 6190429 - 6190892
Public Clones CMHD-GT_424C9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17455
Vector Insertion
Chr 10: 6180061 - 6190437
Public Clones PSTVUpb20b1 (vanderbilt) IST10465H2 (tigm) IST10201D3 (tigm) IST11003A10 (tigm)
IST13946A5 (tigm)
Private Clones OST442584 (lexicon) OST390170 (lexicon) OST287674 (lexicon) OST14317 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117291
Sequence
AGAGTCTAGTCTTTCCTGCTGCTGGCCCTTTACTGTGCCGCTTGGCTCTCTGGTGCCTCCCACGCCAGCCCGGGGAAGAACTTGCAGCCGCATCTCGGCG

CCTGGGGATAACCAGTCACCCCGCACTCTGCAGCAGCATGAGCGTCCGCCTCCCTCTCCTGCTTCGCCAGCTCGGCCGCCAGCAGCTGCCCTCGGGCCCG

GCGTGTCGCCTCCGTGAGCTGTGTCGCTCAGGCAGCAGAAGCAGCAGCAGCGGAGGTGGTGACCCCGAGGGGTTACGCGGGCGGCGGCTGCAGGATGGCC

AAACCTTCAGCAGCCATGGCCCAGGCAATCCGGAAGCCCCCGGGATGGACTCCATCGTCAG - UNI10625 - AGACGTCATTCACAATTCCAAGGAA

GTGCTGAGCTTGTTGCAAGAAAAGAACCCTGCCTTTAAGCCAGTGCTTGTGGTTATTCAG GCCGGTGATGACAATTTGATGAAGGATATGAACCAGAAT

TTGGCCAAGGAG GCTGGTCTGGACATCACTCACATCTGCTTGCCTCCAGACAGCGGAGAGGATGAG ATCATAGATGAAATCCTGAAGATTAATGAAGA

CCCCAGAGTGCATGGCCTTACCCTTCAGATCTCTGAAGATTCATTGAGCAACAAAGTTCTCAATGCTTTGAAACCAGAAAAAGATGTGGACGG GGTGAC

CGACATCAATCTGGGGAAGCTCGTACGAGGTGACGCTCCGGAGTGTTTTGTTTCACCCTTGGCCAAAGCTGCTGTAGAACTTGTTGAAAAGTCAG - UN

I34114 - GGATCACTTTGGATGGAAAGAAGGTCTTGGTCGTAGGGGCGCACGGGCCCCTGGAAGCTGCCCTGCAGTGGCTTTTCCAGAGAAAAGGATC

TATGACAATGAGCTGCCCCTGGGCAACACCTCAGCTTCCAGACAAG - UNI34114 - CTTCGAGAGGCAGACATTGTGGTCTTAGGCTCACCTAAGC

CAGAAGAGATTCCTGCTGTGTGGATTCCATCAGGAACCACCATTCTCAATTGCTTCCATGACTTCTTGTCAG - UNI34114 - GGAAGCTGAGCGGA

GGTTCTCCTGGGGTCCCCGTGGACAAACTCATTGCAGAAGAGAGCGTGAGTCTCCTTGCTGCGGCTCTGCGCATTCAG AACATGGTGAGCAGCGGCAGG

AGGTGGCTCAGAGAGCAGCAACATCGAAGATGGCGACTGCACTGCTTGAAACTGCAGCCTCTCTCACCTGTGCCCAG TGATATTGAGATTTCTCGAGGA

CAGACTCCAAAAGCTGTGGATGTCCTTGCCAAGGAGATAGGATTGCTTGCAGATGAAATTGAAATCTATGGCAAGAGCAAAGCCAAAGTCCAATTGTCCC

TGCTGGAGAGGTTAAAGGATCAAACAGATGGAAAATACGTCTTGGTTGCTGG GATCACGCCCACCCCGCTCGGAGAAGGGAAGAGTACAGTCACCATCG

GACTAGTGCAGGCGCTGACCGCTCACCTGAAAGTCAACTCCTTCGCCTGTCTGAGGCAGCCTTCTCAGGGACCCACTTTTGGAGTGAAAG GAGGAGCTG

CAGGAGGTGGATATGCTCAGGTCATCCCCATGGAGGAG TTCAACCTTCACCTGACTGGGGACATCCATGCCATCACTGCCGCTAATAACTTGCTGGCCG

CAGCCATCGACACGAGAATTTTACATGAGAGCACTCAAACAGACAAG GCTCTCTACAATCGACTGGTTCCCTTAGTGAATGGTGTCAGAGAATTTTCAG

AAATTCAACTTTCTCGGCTGAAG AAACTGGGGATACATAAGACTGATCCAAGCACACTGACCGAGGAGGAAGTGAGGAAGTTCGCCCGCCTCAACATTG

ACCCCGCAACCATCACGTGGCAGAGAG TATTGGACACGAACGACCGATTTCTGAGAAAAATAACCATTGGACAGGGAAGTACAGAGAAAGGATATTCCC

GGCAG GCACAGTTTGACATTGCAGTGGCCAGCGAGATCATGGCCGTGCTGGCCTTGACTGATAGCCTCACAGACATGAAAGAGCGGCTAGGAAGAATGG

TGGTGGCCAGTGACAAAGACGGGCAGCCTGTGACAGCTGAGGACTTG - UNI11099 - GGGGTGACCGGCGCTCTGACAGTTTTGATGAAAGACGCC

ATCAAGCCAAATCTGATGCAGACCCTTGAA - UNI11070 - GGAACACCTGTGTTTGTGCACGCTGGTCCCTTTGCCAACATCGCTCACGGCAACTC

ATCAGTATTAGCTGATAAAATCGCGCTGAAATTGGTCGGCGAAGAAGGGTTTGTGG - UNI11091 - TGACTGAAGCTGGCTTTGGGGCTGATATTG

GGATGGAGAAATTCTTCAATATCAAATGCCGAGCTTCTGGCCTGGTGCCCAACGTTGTCGTGCTGGTAGCCACCGTTCGAGCTCTGAAGATGCATGGAGG

CGGGCCGAGT - UNI27978 - GTAACTGCTGGGGTTCCTCTCAAGAAAGAATATACAGAGGAG - UNI20858 - AACATTCAGCTGGTAGCTGA

TGGCTGCTGCAACCTACAGAAGCAAATTCAGATCGCTCAGCTCTTCGGGGTGCCGGTGGTGGTGGCACTGAATGTCTTCAA GACGGACACCCGTGCAGA

GATTGACTTGGTGTGTGAGCTCGCTAAACGGGCCGGTGCCTTTGATGCGGTCCCCTGCTATCACTGGTCGGCTGGAGGGAAAGGATCTGTGGACTTGGCC

CGGGCTGTGAGAGAAGCTGCGAATAAAAGAAGCCGCTTCCAGTTCCTGTATGATGTTCAG - UNI10586 - CTTCCCATCGTGGAAAAGATAAGAGT

CATTGCCCAGACTGTCTATGGAGCCAAGGACATTGAGCTGTCTCCTGAGGCGCAGTCCAAAATCGATCGCTATACGCAACAG - UNI10947 - GGTT

TTGGAAATTTGCCCATTTGCATGGCGAAGACCCACCTCTCTCTCTCTCATGAACCTGACAAAAAGGGAGTGCCGAGGGATTTCACTCTGCCCATCAGTGA

TGTCCGGGCCAGCATCGGGGCTGGGTTCATTTATCCTTTGGTGGGAACG - UNI663 - ATGAGCACAATGCCAGGACTGCCCACCCGACCCTGCTTT

TATGATATAGACCTTGACACAGAAACGGAGCAAGTTAAAGGCTTGTTCTAATGGAATGAAACCCACAGGACTGGGCAAG - UNI13940 - AAAACAG

CTCACACAAGAATCCCAGCCTTTAAAACCACAACACAAGTAAGAGTTTAACACCAGAGGAAAAGACGACTTGGCTCTGAGACCCCACCCCCTCTTTTTCA

GAGTCTTCAAACAAAAAACGTCTCCTTGCCTTTTTGCTGCAGTTGGAGAAGAAAATGAATTTTGAAATCTTGTGATGCAATGCTGGAGCAATCCTGAGAC

AGGCCAAAGACCGCTTCCTCATACAAGATTAACTCTGTTTCCAGCCAAGTGGTGTTCAACAGAAGGACCTGCGCCACATCTGGAAGGAGTGAAGTTACTC

TTGGTTCCGATAGTGTTTACACCATTTCTGCTGCTTATACTTTAGAAAGTTTATTTTATGGGGACTAGGGCTTTGCAAGAGTGTGAACTAAAAGCTAATG

CTTCCGTCTTTGGAGTTTTCTCTTTCATCTTTTTTATTCTTCCTTTCCTCACCTGTGTTGAGGATGGGATGTCAGGCCTCTGCTTGCACCGTCCAGCGCT

GTGCTGCCAAACTGTATTTGTTTTTGTCTTTGAACTGAAAATAAACATGTGTTCTAGAAAACC
Translation
MSVRLPLLLRQLGRQQLPSGPACRLRELCRSGSRSSSSGGGDPEGLRGRRLQDGQTFSSHGPGNPEAPGMDSIVR - UNI10625 - RDVIHNSKEVL

SLLQEKNPAFKPVLVVIQ AGDDNLMKDMNQNLAKE AGLDITHICLPPDSGEDE IIDEILKINEDPRVHGLTLQISEDSLSNKVLNALKPEKDVDG G

VTDINLGKLVRGDAPECFVSPLAKAAVELVEKSG - UNI34114 - GITLDGKKVLVVGAHGPLEAALQWLFQRKGSMTMSCPWATPQLPDK - UNI

34114 - LREADIVVLGSPKPEEIPAVWIPSGTTILNCFHDFLSG - UNI34114 - GKLSGGSPGVPVDKLIAEESVSLLAAALRIQ NMVSSGRR

WLREQQHRRWRLHCLKLQPLSPVPS SDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVQLSLLERLKDQTDGKYVLVAG GITPTPLGEGKSTV

TIGLVQALTAHLKVNSFACLRQPSQGPTFGVKG GGAAGGGYAQVIPMEE FNLHLTGDIHAITAANNLLAAAIDTRILHESTQTDK ALYNRLVPLVNG

VREFSEIQLSRLK KLGIHKTDPSTLTEEEVRKFARLNIDPATITWQRV VLDTNDRFLRKITIGQGSTEKGYSRQ AQFDIAVASEIMAVLALTDSLTD

MKERLGRMVVASDKDGQPVTAEDL - UNI11099 - GVTGALTVLMKDAIKPNLMQTLE - UNI11070 - GTPVFVHAGPFANIAHGNSSVLADK

IALKLVGEEGFVV - UNI11091 - VTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPS - UNI27978 - VTAGVPLKKEYT

EE - UNI20858 - NIQLVADGCCNLQKQIQIAQLFGVPVVVALNVFK KTDTRAEIDLVCELAKRAGAFDAVPCYHWSAGGKGSVDLARAVREAANK

RSRFQFLYDVQ - UNI10586 - LPIVEKIRVIAQTVYGAKDIELSPEAQSKIDRYTQQ - UNI10947 - GFGNLPICMAKTHLSLSHEPDKKGV

PRDFTLPISDVRASIGAGFIYPLVGT - UNI663 - MSTMPGLPTRPCFYDIDLDTETEQVKGLF - UNI13940 - 
Transcript ENSMUST00000120585
Sequence
TCCTGCTGCTGGCCCTTTACTGTGCCGCTTGGCTCTCTGGTGCCTCCCACGCCAGCCCGGGGAAGAACTTGCAGCCGCATCTCGGCGCCTGGGGATAACC

AGTCACCCCGCACTCTGCAGCAGCATGAGCGTCCGCCTCCCTCTCCTGCTTCGCCAGCTCGGCCGCCAGCAGCTGCCCTCGGGCCCGGCGTGTCGCCTCC

GTGAGCTGTGTCGCTCAGGCAGCAGAAGCAGCAGCAGCGGAGGTGGTGACCCCGAGGGGTTACGCGGGCGGCGGCTGCAGGATGGCCAAACCTTCAGCAG

CCATGGCCCAGGCAATCCGGAAGCCCCCGGGATGGACTCCATCGTCAG - UNI10625 - AGACGTCATTCACAATTCCAAGGAAGTGCTGAGCTTGT

TGCAAGAAAAGAACCCTGCCTTTAAGCCAGTGCTTGTGGTTATTCAG GCCGGTGATGACAATTTGATGAAGGATATGAACCAGAATTTGGCCAAGGAG 

GCTGGTCTGGACATCACTCACATCTGCTTGCCTCCAGACAGCGGAGAGGATGAG ATCATAGATGAAATCCTGAAGATTAATGAAGACCCCAGAGTGCAT

GGCCTTACCCTTCAGATCTCTGAAGATTCATTGAGCAACAAAGTTCTCAATGCTTTGAAACCAGAAAAAGATGTGGACGG GGTGACCGACATCAATCTG

GGGAAGCTCGTACGAGGTGACGCTCCGGAGTGTTTTGTTTCACCCTTGGCCAAAGCTGCTGTAGAACTTGTTGAAAAGTCAG - UNI34114 - GGAT

CACTTTGGATGGAAAGAAGGTCTTGGTCGTAGGGGCGCACGGGCCCCTGGAAGCTGCCCTGCAGTGGCTTTTCCAGAGAAAAGGATCTATGACAATGAGC

TGCCCCTGGGCAACACCTCAGCTTCCAGACAAG - UNI34114 - CTTCGAGAGGCAGACATTGTGGTCTTAGGCTCACCTAAGCCAGAAGAGATTCC

TGCTGTGTGGATTCCATCAGGAACCACCATTCTCAATTGCTTCCATGACTTCTTGTCAG - UNI34114 - GGAAGCTGAGCGGAGGTTCTCCTGGGG

TCCCCGTGGACAAACTCATTGCAGAAGAGAGCGTGAGTCTCCTTGCTGCGGCTCTGCGCATTCAG AACATGGTGAGCAGCGGCAGGAGGTGGCTCAGAG

AGCAGCAACATCGAAGATGGCGACTGCACTGCTTGAAACTGCAGCCTCTCTCACCTGTGCCCAG TGATATTGAGATTTCTCGAGGACAGACTCCAAAAG

CTGTGGATGTCCTTGCCAAGGAGATAGGATTGCTTGCAGATGAAATTGAAATCTATGGCAAGAGCAAAGCCAAAGTCCAATTGTCCCTGCTGGAGAGGTT

AAAGGATCAAACAGATGGAAAATACGTCTTGGTTGCTGG GATCACGCCCACCCCGCTCGGAGAAGGGAAGAGTACAGTCACCATCGGACTAGTGCAGGC

GCTGACCGCTCACCTGAAAGTCAACTCCTTCGCCTGTCTGAGGCAGCCTTCTCAGGGACCCACTTTTGGAGTGAAAG GAGGAGCTGCAGGAGGTGGATA

TGCTCAGGTCATCCCCATGGAGGAG TTCAACCTTCACCTGACTGGGGACATCCATGCCATCACTGCCGCTAATAACTTGCTGGCCGCAGCCATCGACAC

GAGAATTTTACATGAGAGCACTCAAACAGACAAG GCTCTCTACAATCGACTGGTTCCCTTAGTGAATGGTGTCAGAGAATTTTCAGAAATTCAACTTTC

TCGGCTGAAG AAACTGGGGATACATAAGACTGATCCAAGCACACTGACCGAGGAGGAAGTGAGGAAGTTCGCCCGCCTCAACATTGACCCCGCAACCAT

CACGTGGCAGAGAG TATTGGACACGAACGACCGATTTCTGAGAAAAATAACCATTGGACAGGGAAGTACAGAGAAAGGATATTCCCGGCAG GCACAGT

TTGACATTGCAGTGGCCAGCGAGATCATGGCCGTGCTGGCCTTGACTGATAGCCTCACAGACATGAAAGAGCGGCTAGGAAGAATGGTGGTGGCCAGTGA

CAAAGACGGGCAGCCTGTGACAGCTGAGGACTTG - UNI11099 - GGGGTGACCGGCGCTCTGACAGTTTTGATGAAAGACGCCATCAAGCCAAATC

TGATGCAGACCCTTGAA - UNI11070 - GGAACACCTGTGTTTGTGCACGCTGGTCCCTTTGCCAACATCGCTCACGGCAACTCATCAGTATTAGCT

GATAAAATCGCGCTGAAATTGGTCGGCGAAGAAGGGTTTGTGG - UNI11091 - TGACTGAAGCTGGCTTTGGGGCTGATATTGGGATGGAGAAATT

CTTCAATATCAAATGCCGAGCTTCTGGCCTGGTGCCCAACGTTGTCGTGCTGGTAGCCACCGTTCGAGCTCTGAAGATGCATGGAGGCGGGCCGAGT - 

UNI27978 - GTAACTGCTGGGGTTCCTCTCAAGAAAGAATATACAGAGGAG - UNI20858 - AACATTCAGCTGGTAGCTGATGGCTGCTGCAAC

CTACAGAAGCAAATTCAGATCGCTCAGCTCTTCGGGGTGCCGGTGGTGGTGGCACTGAATGTCTTCAA GACGGACACCCGTGCAGAGATTGACTTGGTG

TGTGAGCTCGCTAAACGGGCCGGTGCCTTTGATGCGGTCCCCTGCTATCACTGGTCGGCTGGAGGGAAAGGATCTGTGGACTTGGCCCGGGCTGTGAGAG

AAGCTGCGAATAAAAGAAGCCGCTTCCAGTTCCTGTATGATGTTCAG - UNI10586 - CTTCCCATCGTGGAAAAGATAAGAGTCATTGCCCAGACT

GTCTATGGAGCCAAGGACATTGAGCTGTCTCCTGAGGCGCAGTCCAAAATCGATCGCTATACGCAACAG - UNI10947 - GGTTTTGGAAATTTGCC

CATTTGCATGGCGAAGACCCACCTCTCTCTCTCTCATGAACCTGACAAAAAGGGAGTGCCGAGGGATTTCACTCTGCCCATCAGTGATGTCCGGGCCAGC

ATCGGGGCTGGGTTCATTTATCCTTTGGTGGGAACG - UNI663 - ATGAGCACAATGCCAGGACTGCCCACCCGACCCTGCTTTTATGATATAGACC

TTGACACAGAAACGGAGCAAGTTAAAGGCTTGTTCTAATGGAATGAAACCCACAGGACTGGGCAAG - UNI13940 - - UNI17455 - - UNI30

365 - ATGCGGTCAAGGCTGGACCCCTTCTAGCATCCAGGCCTGGAAACAGACATCAGCTGACTCCCAGGCATGCAGTGAAGATCAGATCAGTGGACCT

CCAAATATTCTCTTTTTTTTTTTCTTTCTCCCTAAACCTCATCCAAAGTCAGGTCTCGTAGCGAAAAGCACATGGGACATGTCCATGTGTTACCCAGTCA

CACCCACAGAAGAACTGAGGCAAGACCACGAAAGAACCACTGATCTCTGGTGCACTGTGCAGAACAAAACCATGGAGCGTCTACTTCTATTGATTAAAAT

TATCAAATTAGATAACAAAAAATAAACCACCCATATTGAGATATTTTATACCCATGAAGAATGTGTTAGAGCTATCATTGGTCAAAACAATGAAATGAGC

TTTGGAAAATACGTCAATTTGAAAAGCATTCATCTGGATGTAACAAAGACAGATCTGAAAATTGTATTAACATGCTTAACCAAACCAGGAGTACTGGGGA

GGGGCACACCTAGCATCCCATTGAGATGGAGGCAGAAGGATCAGGAGTTCAAGGTCACACCAGCTACACTGTGAGTTCCAAGTTACAGAGAAAAACCCTG

TCTCAAC
Translation
MSVRLPLLLRQLGRQQLPSGPACRLRELCRSGSRSSSSGGGDPEGLRGRRLQDGQTFSSHGPGNPEAPGMDSIVR - UNI10625 - RDVIHNSKEVL

SLLQEKNPAFKPVLVVIQ AGDDNLMKDMNQNLAKE AGLDITHICLPPDSGEDE IIDEILKINEDPRVHGLTLQISEDSLSNKVLNALKPEKDVDG G

VTDINLGKLVRGDAPECFVSPLAKAAVELVEKSG - UNI34114 - GITLDGKKVLVVGAHGPLEAALQWLFQRKGSMTMSCPWATPQLPDK - UNI

34114 - LREADIVVLGSPKPEEIPAVWIPSGTTILNCFHDFLSG - UNI34114 - GKLSGGSPGVPVDKLIAEESVSLLAAALRIQ NMVSSGRR

WLREQQHRRWRLHCLKLQPLSPVPS SDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVQLSLLERLKDQTDGKYVLVAG GITPTPLGEGKSTV

TIGLVQALTAHLKVNSFACLRQPSQGPTFGVKG GGAAGGGYAQVIPMEE FNLHLTGDIHAITAANNLLAAAIDTRILHESTQTDK ALYNRLVPLVNG

VREFSEIQLSRLK KLGIHKTDPSTLTEEEVRKFARLNIDPATITWQRV VLDTNDRFLRKITIGQGSTEKGYSRQ AQFDIAVASEIMAVLALTDSLTD

MKERLGRMVVASDKDGQPVTAEDL - UNI11099 - GVTGALTVLMKDAIKPNLMQTLE - UNI11070 - GTPVFVHAGPFANIAHGNSSVLADK

IALKLVGEEGFVV - UNI11091 - VTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPS - UNI27978 - VTAGVPLKKEYT

EE - UNI20858 - NIQLVADGCCNLQKQIQIAQLFGVPVVVALNVFK KTDTRAEIDLVCELAKRAGAFDAVPCYHWSAGGKGSVDLARAVREAANK

RSRFQFLYDVQ - UNI10586 - LPIVEKIRVIAQTVYGAKDIELSPEAQSKIDRYTQQ - UNI10947 - GFGNLPICMAKTHLSLSHEPDKKGV

PRDFTLPISDVRASIGAGFIYPLVGT - UNI663 - MSTMPGLPTRPCFYDIDLDTETEQVKGLF - UNI13940 - - UNI17455 - - UNI3

0365 - 
Transcript ENSMUST00000043735
Sequence
CCTTTACTGTGCCGCTTGGCTCTCTGGTGCCTCCCACGCCAGCCCGGGGAAGAACTTGCAGCCGCATCTCGGCGCCTGGGGATAACCAGTCACCCCGCAC

TCTGCAGCAGCATGAGCGTCCGCCTCCCTCTCCTGCTTCGCCAGCTCGGCCGCCAGCAGCTGCCCTCGGGCCCGGCGTGTCGCCTCCGTGAGCTGTGTCG

CTCAGGCAGCAGAAGCAGCAGCAGCGGAGGTGGTGACCCCGAGGGGTTACGCGGGCGGCGGCTGCAGGATGGCCAAACCTTCAGCAGCCATGGCCCAGGC

AATCCGGAAGCCCCCGGGATGGACTCCATCGTCAG - UNI10625 - AGACGTCATTCACAATTCCAAGGAAGTGCTGAGCTTGTTGCAAGAAAAGAA

CCCTGCCTTTAAGCCAGTGCTTGTGGTTATTCAG GCCGGTGATGACAATTTGATGAAGGATATGAACCAGAATTTGGCCAAGGAG GCTGGTCTGGACA

TCACTCACATCTGCTTGCCTCCAGACAGCGGAGAGGATGAG ATCATAGATGAAATCCTGAAGATTAATGAAGACCCCAGAGTGCATGGCCTTACCCTTC

AGATCTCTGAAGATTCATTGAGCAACAAAGTTCTCAATGCTTTGAAACCAGAAAAAGATGTGGACGG GGTGACCGACATCAATCTGGGGAAGCTCGTAC

GAGGTGACGCTCCGGAGTGTTTTGTTTCACCCTTGGCCAAAGCTGCTGTAGAACTTGTTGAAAAGTCAG - UNI34114 - GGATCACTTTGGATGGA

AAGAAGGTCTTGGTCGTAGGGGCGCACGGGCCCCTGGAAGCTGCCCTGCAGTGGCTTTTCCAGAGAAAAGGATCTATGACAATGAGCTGCCCCTGGGCAA

CACCTCAGCTTCCAGACAAG - UNI34114 - CTTCGAGAGGCAGACATTGTGGTCTTAGGCTCACCTAAGCCAGAAGAGATTCCTGCTGTGTGGATT

CCATCAGGAACCACCATTCTCAATTGCTTCCATGACTTCTTGTCAG - UNI34114 - GGAAGCTGAGCGGAGGTTCTCCTGGGGTCCCCGTGGACAA

ACTCATTGCAGAAGAGAGCGTGAGTCTCCTTGCTGCGGCTCTGCGCATTCAG AACATGGTGAGCAGCGGCAGGAGGTGGCTCAGAGAGCAGCAACATCG

AAGATGGCGACTGCACTGCTTGAAACTGCAGCCTCTCTCACCTGTGCCCAG TGATATTGAGATTTCTCGAGGACAGACTCCAAAAGCTGTGGATGTCCT

TGCCAAGGAGATAGGATTGCTTGCAGATGAAATTGAAATCTATGGCAAGAGCAAAGCCAAAGTCCAATTGTCCCTGCTGGAGAGGTTAAAGGATCAAACA

GATGGAAAATACGTCTTGGTTGCTGG GATCACGCCCACCCCGCTCGGAGAAGGGAAGAGTACAGTCACCATCGGACTAGTGCAGGCGCTGACCGCTCAC

CTGAAAGTCAACTCCTTCGCCTGTCTGAGGCAGCCTTCTCAGGGACCCACTTTTGGAGTGAAAG GAGGAGCTGCAGGAGGTGGATATGCTCAGGTCATC

CCCATGGAGGAG TTCAACCTTCACCTGACTGGGGACATCCATGCCATCACTGCCGCTAATAACTTGCTGGCCGCAGCCATCGACACGAGAATTTTACAT

GAGAGCACTCAAACAGACAAG GCTCTCTACAATCGACTGGTTCCCTTAGTGAATGGTGTCAGAGAATTTTCAGAAATTCAACTTTCTCGGCTGAAG AA

ACTGGGGATACATAAGACTGATCCAAGCACACTGACCGAGGAGGAAGTGAGGAAGTTCGCCCGCCTCAACATTGACCCCGCAACCATCACGTGGCAGAGA

G TATTGGACACGAACGACCGATTTCTGAGAAAAATAACCATTGGACAGGGAAGTACAGAGAAAGGATATTCCCGGCAG GCACAGTTTGACATTGCAGT

GGCCAGCGAGATCATGGCCGTGCTGGCCTTGACTGATAGCCTCACAGACATGAAAGAGCGGCTAGGAAGAATGGTGGTGGCCAGTGACAAAGACGGGCAG

CCTGTGACAGCTGAGGACTTG - UNI11099 - GGGGTGACCGGCGCTCTGACAGTTTTGATGAAAGACGCCATCAAGCCAAATCTGATGCAGACCCT

TGAA - UNI11070 - GGAACACCTGTGTTTGTGCACGCTGGTCCCTTTGCCAACATCGCTCACGGCAACTCATCAGTATTAGCTGATAAAATCGCGC

TGAAATTGGTCGGCGAAGAAGGGTTTGTGG - UNI11091 - TGACTGAAGCTGGCTTTGGGGCTGATATTGGGATGGAGAAATTCTTCAATATCAAA

TGCCGAGCTTCTGGCCTGGTGCCCAACGTTGTCGTGCTGGTAGCCACCGTTCGAGCTCTGAAGATGCATGGAGGCGGGCCGAGT - UNI27978 - GT

AACTGCTGGGGTTCCTCTCAAGAAAGAATATACAGAGGAG - UNI20858 - AACATTCAGCTGGTAGCTGATGGCTGCTGCAACCTACAGAAGCAAA

TTCAGATCGCTCAGCTCTTCGGGGTGCCGGTGGTGGTGGCACTGAATGTCTTCAA GACGGACACCCGTGCAGAGATTGACTTGGTGTGTGAGCTCGCTA

AACGGGCCGGTGCCTTTGATGCGGTCCCCTGCTATCACTGGTCGGCTGGAGGGAAAGGATCTGTGGACTTGGCCCGGGCTGTGAGAGAAGCTGCGAATAA

AAGAAGCCGCTTCCAGTTCCTGTATGATGTTCAG - UNI10586 - CTTCCCATCGTGGAAAAGATAAGAGTCATTGCCCAGACTGTCTATGGAGCCA

AGGACATTGAGCTGTCTCCTGAGGCGCAGTCCAAAATCGATCGCTATACGCAACAG - UNI10947 - GGTTTTGGAAATTTGCCCATTTGCATGGCG

AAGACCCACCTCTCTCTCTCTCATGAACCTGACAAAAAGGGAGTGCCGAGGGATTTCACTCTGCCCATCAGTGATGTCCGGGCCAGCATCGGGGCTGGGT

TCATTTATCCTTTGGTGGGAACG - UNI663 - ATGAGCACAATGCCAGGACTGCCCACCCGACCCTGCTTTTATGATATAGACCTTGACACAGAAAC

GGAGCAAGTTAAAGGCTTGTTCTAATGGAATGAAACCCACAGGACTGGGCAAG - UNI13940 - - UNI30365 - AGTCTTCAAACAAAAAACGT

CTCCTTGCCTTTTTGCTGCAGTTGGAGAAGAAAATGAATTTTGAAATCTTGTGATGCAATGCTGGAGCAATCCTGAGACAGGCCAAAGACCGCTTCCTCA

TACAAGATTAACTCTGTTTCCAGCCAAGTGGTGTTCAACAGAAGGACCTGCGCCACATCTGGAAGGAGTGAAGTTACTCTTGGTTCCGATAGTGTTTACA

CCATTTCTGCTGCTTATACTTTAGAAAGTTTATTTTATGGGGACTAGGGCTTTGCAAGAGTGTGAACTAAAAGCTAATGCTTCCGTCTTTGGAGTTTTCT

CTTTCATCTTTTTTATTCTTCCTTTCCTCACCTGTGTTGAGGATGGGATGTCAGGCCTCTGCTTGCACCGTCCAGCGCTGTGCTGCCAAACTGTATTTGT

TTTTGTCTTTGAACTGAAAATAAACATGTGTTCT
Translation
MSVRLPLLLRQLGRQQLPSGPACRLRELCRSGSRSSSSGGGDPEGLRGRRLQDGQTFSSHGPGNPEAPGMDSIVR - UNI10625 - RDVIHNSKEVL

SLLQEKNPAFKPVLVVIQ AGDDNLMKDMNQNLAKE AGLDITHICLPPDSGEDE IIDEILKINEDPRVHGLTLQISEDSLSNKVLNALKPEKDVDG G

VTDINLGKLVRGDAPECFVSPLAKAAVELVEKSG - UNI34114 - GITLDGKKVLVVGAHGPLEAALQWLFQRKGSMTMSCPWATPQLPDK - UNI

34114 - LREADIVVLGSPKPEEIPAVWIPSGTTILNCFHDFLSG - UNI34114 - GKLSGGSPGVPVDKLIAEESVSLLAAALRIQ NMVSSGRR

WLREQQHRRWRLHCLKLQPLSPVPS SDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVQLSLLERLKDQTDGKYVLVAG GITPTPLGEGKSTV

TIGLVQALTAHLKVNSFACLRQPSQGPTFGVKG GGAAGGGYAQVIPMEE FNLHLTGDIHAITAANNLLAAAIDTRILHESTQTDK ALYNRLVPLVNG

VREFSEIQLSRLK KLGIHKTDPSTLTEEEVRKFARLNIDPATITWQRV VLDTNDRFLRKITIGQGSTEKGYSRQ AQFDIAVASEIMAVLALTDSLTD

MKERLGRMVVASDKDGQPVTAEDL - UNI11099 - GVTGALTVLMKDAIKPNLMQTLE - UNI11070 - GTPVFVHAGPFANIAHGNSSVLADK

IALKLVGEEGFVV - UNI11091 - VTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPS - UNI27978 - VTAGVPLKKEYT

EE - UNI20858 - NIQLVADGCCNLQKQIQIAQLFGVPVVVALNVFK KTDTRAEIDLVCELAKRAGAFDAVPCYHWSAGGKGSVDLARAVREAANK

RSRFQFLYDVQ - UNI10586 - LPIVEKIRVIAQTVYGAKDIELSPEAQSKIDRYTQQ - UNI10947 - GFGNLPICMAKTHLSLSHEPDKKGV

PRDFTLPISDVRASIGAGFIYPLVGT - UNI663 - MSTMPGLPTRPCFYDIDLDTETEQVKGLF - UNI13940 - - UNI30365 - 
Transcript ENSMUST00000105585
Sequence
GAGGAAGAGTCTAGTCTTTCCTGCTGCTGGCCCTTTACTGTGCCGCTTGGCTCTCTGGTGCCTCCCACGCCAGCCCGGGGAAGAACTTGCAGCCGCATCT

CGGCGCCTGGGGATAACCAGTCACCCCGCACTCTGCAGCAGCATGAGCGTCCGCCTCCCTCTCCTGCTTCGCCAGCTCGGCCGCCAGCAGCTGCCCTCGG

GCCCGGCGTGTCGCCTCCGTGAGCTGTGTCGCTCAGGCAGCAGAAGCAGCAGCAGCGGAGGTGGTGACCCCGAGGGGTTACGCGGGCGGCGGCTGCAGGA

TGGCCAAACCTTCAGCAGCCATGGCCCAGGCAATCCGGAAGCCCCCGGGATGGACTCCATCGTCAG - UNI10625 - AGACGTCATTCACAATTCCA

AGGAAGTGCTGAGCTTGTTGCAAGAAAAGAACCCTGCCTTTAAGCCAGTGCTTGTGGTTATTCAG GCCGGTGATGACAATTTGATGAAGGATATGAACC

AGAATTTGGCCAAGGAG GCTGGTCTGGACATCACTCACATCTGCTTGCCTCCAGACAGCGGAGAGGATGAG ATCATAGATGAAATCCTGAAGATTAAT

GAAGACCCCAGAGTGCATGGCCTTACCCTTCAGATCTCTGAAGATTCATTGAGCAACAAAGTTCTCAATGCTTTGAAACCAGAAAAAGATGTGGACGG G

GTGACCGACATCAATCTGGGGAAGCTCGTACGAGGTGACGCTCCGGAGTGTTTTGTTTCACCCTTGGCCAAAGCTGCTGTAGAACTTGTTGAAAAGTCAG

 - UNI34114 - GGATCACTTTGGATGGAAAGAAGGTCTTGGTCGTAGGGGCGCACGGGCCCCTGGAAGCTGCCCTGCAGTGGCTTTTCCAGAGAAAA

GGATCTATGACAATGAGCTGCCCCTGGGCAACACCTCAGCTTCCAGACAAG - UNI34114 - CTTCGAGAGGCAGACATTGTGGTCTTAGGCTCACC

TAAGCCAGAAGAGATTCCTGCTGTGTGGATTCCATCAGGAACCACCATTCTCAATTGCTTCCATGACTTCTTGTCAG - UNI34114 - GGAAGCTGA

GCGGAGGTTCTCCTGGGGTCCCCGTGGACAAACTCATTGCAGAAGAGAGCGTGAGTCTCCTTGCTGCGGCTCTGCGCATTCAG AACATGGTGAGCAGCG

GCAGGAGGTGGCTCAGAGAGCAGCAACATCGAAGATGGCGACTGCACTGCTTGAAACTGCAGCCTCTCTCACCTGTGCCCAG TGATATTGAGATTTCTC

GAGGACAGACTCCAAAAGCTGTGGATGTCCTTGCCAAGGAGATAGGATTGCTTGCAGATGAAATTGAAATCTATGGCAAGAGCAAAGCCAAAGTCCAATT

GTCCCTGCTGGAGAGGTTAAAGGATCAAACAGATGGAAAATACGTCTTGGTTGCTGG GATCACGCCCACCCCGCTCGGAGAAGGGAAGAGTACAGTCAC

CATCGGACTAGTGCAGGCGCTGACCGCTCACCTGAAAGTCAACTCCTTCGCCTGTCTGAGGCAGCCTTCTCAGGGACCCACTTTTGGAGTGAAAG GAGG

AGCTGCAGGAGGTGGATATGCTCAGGTCATCCCCATGGAGGAG TTCAACCTTCACCTGACTGGGGACATCCATGCCATCACTGCCGCTAATAACTTGCT

GGCCGCAGCCATCGACACGAGAATTTTACATGAGAGCACTCAAACAGACAAG GCTCTCTACAATCGACTGGTTCCCTTAGTGAATGGTGTCAGAGAATT

TTCAGAAATTCAACTTTCTCGGCTGAAG AAACTGGGGATACATAAGACTGATCCAAGCACACTGACCGAGGAGGAAGTGAGGAAGTTCGCCCGCCTCAA

CATTGACCCCGCAACCATCACGTGGCAGAGAG TATTGGACACGAACGACCGATTTCTGAGAAAAATAACCATTGGACAGGGAAGTACAGAGAAAGGATA

TTCCCGGCAG GCACAGTTTGACATTGCAGTGGCCAGCGAGATCATGGCCGTGCTGGCCTTGACTGATAGCCTCACAGACATGAAAGAGCGGCTAGGAAG

AATGGTGGTGGCCAGTGACAAAGACGGGCAGCCTGTGACAGCTGAGGACTTG - UNI11099 - GGGGTGACCGGCGCTCTGACAGTTTTGATGAAAG

ACGCCATCAAGCCAAATCTGATGCAGACCCTTGAA - UNI11070 - GGAACACCTGTGTTTGTGCACGCTGGTCCCTTTGCCAACATCGCTCACGGC

AACTCATCAGTATTAGCTGATAAAATCGCGCTGAAATTGGTCGGCGAAGAAGGGTTTGTGG - UNI11091 - TGACTGAAGCTGGCTTTGGGGCTGA

TATTGGGATGGAGAAATTCTTCAATATCAAATGCCGAGCTTCTGGCCTGGTGCCCAACGTTGTCGTGCTGGTAGCCACCGTTCGAGCTCTGAAGATGCAT

GGAGGCGGGCCGAGT - UNI27978 - GTAACTGCTGGGGTTCCTCTCAAGAAAGAATATACAGAGGAG - UNI20858 - AACATTCAGCTGGTA

GCTGATGGCTGCTGCAACCTACAGAAGCAAATTCAGATCGCTCAGCTCTTCGGGGTGCCGGTGGTGGTGGCACTGAATGTCTTCAA GACGGACACCCGT

GCAGAGATTGACTTGGTGTGTGAGCTCGCTAAACGGGCCGGTGCCTTTGATGCGGTCCCCTGCTATCACTGGTCGGCTGGAGGGAAAGGATCTGTGGACT

TGGCCCGGGCTGTGAGAGAAGCTGCGAATAAAAGAAGCCGCTTCCAGTTCCTGTATGATGTTCAG - UNI10586 - CTTCCCATCGTGGAAAAGATA

AGAGTCATTGCCCAGACTGTCTATGGAGCCAAGGACATTGAGCTGTCTCCTGAGGCGCAGTCCAAAATCGATCGCTATACGCAACAG - UNI10947 -

 GGTTTTGGAAATTTGCCCATTTGCATGGCGAAGACCCACCTCTCTCTCTCTCATGAACCTGACAAAAAGGGAGTGCCGAGGGATTTCACTCTGCCCATC

AGTGATGTCCGGGCCAGCATCGGGGCTGGGTTCATTTATCCTTTGGTGGGAACG - UNI663 - ATGAGCACAATGCCAGGACTGCCCACCCGACCCT

GCTTTTATGATATAGACCTTGACACAGAAACGGAGCAAGTTAAAGGCTTGTTCTAATGGAATGAAACCCACAGGACTGGGCAAG - UNI13940 - AA

AACAGCTCACACAAGAATCCCAGCCTTTAAAACCACAACACAAGTAAGAGTTTAACACCAGAGGAAAAGACGACTTGGCTCTGAGACCCCACCCCCTCTT

TTTCAGAGTCTTCAAACAAAAAACGTCTCCTTGCCTTTTTGCTGCAGTTGGAGAAGAAAATGAATTTTGAAATCTTGTGATGCAATGCTGGAGCAATCCT

GAGACAGGCCAAAGACCGCTTCCTCATACAAGATTAACTCTGTTTCCAGCCAAGTGGTGTTCAACAGAAGGACCTGCGCCACATCTGGAAGGAGTGAAGT

TACTCTTGGTTCCGATAGTGTTTACACCATTTCTGCTGCTTATACTTTAGAAAGTTTATTTTATGGGGACTAGGGCTTTGCAAGAGTGTGAACTAAAAGC

TAATGCTTCCGTCTTTGGAGTTTTCTCTTTCATCTTTTTTATTCTTCCTTTCCTCACCTGTGTTGAGGATGGGATGTCAGGCCTCTGCTTGCACCGTCCA

GCGCTGTGCTGCCAAACTGTATTTGTTTTTGTCTTTGAACTGAAAATAAACATGTGTTCTAGAAAACC
Translation
RKSLVFPAAGPLLCRLALWCLPRQPGEELAAASRRLGITSHPALCSSMSVRLPLLLRQLGRQQLPSGPACRLRELCRSGSRSSSSGGGDPEGLRGRRLQD

GQTFSSHGPGNPEAPGMDSIVR - UNI10625 - RDVIHNSKEVLSLLQEKNPAFKPVLVVIQ AGDDNLMKDMNQNLAKE AGLDITHICLPPDSGE

DE IIDEILKINEDPRVHGLTLQISEDSLSNKVLNALKPEKDVDG GVTDINLGKLVRGDAPECFVSPLAKAAVELVEKSG - UNI34114 - GITLD

GKKVLVVGAHGPLEAALQWLFQRKGSMTMSCPWATPQLPDK - UNI34114 - LREADIVVLGSPKPEEIPAVWIPSGTTILNCFHDFLSG - UNI3

4114 - GKLSGGSPGVPVDKLIAEESVSLLAAALRIQ NMVSSGRRWLREQQHRRWRLHCLKLQPLSPVPS SDIEISRGQTPKAVDVLAKEIGLLADE

IEIYGKSKAKVQLSLLERLKDQTDGKYVLVAG GITPTPLGEGKSTVTIGLVQALTAHLKVNSFACLRQPSQGPTFGVKG GGAAGGGYAQVIPMEE FN

LHLTGDIHAITAANNLLAAAIDTRILHESTQTDK ALYNRLVPLVNGVREFSEIQLSRLK KLGIHKTDPSTLTEEEVRKFARLNIDPATITWQRV VLD

TNDRFLRKITIGQGSTEKGYSRQ AQFDIAVASEIMAVLALTDSLTDMKERLGRMVVASDKDGQPVTAEDL - UNI11099 - GVTGALTVLMKDAIK

PNLMQTLE - UNI11070 - GTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVV - UNI11091 - VTEAGFGADIGMEKFFNIKCRASGLV

PNVVVLVATVRALKMHGGGPS - UNI27978 - VTAGVPLKKEYTEE - UNI20858 - NIQLVADGCCNLQKQIQIAQLFGVPVVVALNVFK KT

DTRAEIDLVCELAKRAGAFDAVPCYHWSAGGKGSVDLARAVREAANKRSRFQFLYDVQ - UNI10586 - LPIVEKIRVIAQTVYGAKDIELSPEAQS

KIDRYTQQ - UNI10947 - GFGNLPICMAKTHLSLSHEPDKKGVPRDFTLPISDVRASIGAGFIYPLVGT - UNI663 - MSTMPGLPTRPCFYD

IDLDTETEQVKGLF - UNI13940 - 

For any suggestions or comments, please send an email to unitrap@crg.es