Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040711 (Sh3pxd2b)
Chromosomal location
Chr 11: 32247811 - 32328183 (+)
Description
SH3 and PX domains 2B Gene [Source:MGI (curated);Acc:Sh3pxd2b-001]
RefSeq_dna
NM_177364 
RefSeq_peptide
NP_796338.2 
MGI
MGI:2442062 
Uniprot/SWISSPROT
A2AAY5 
Uniprot/SPTREMBL
Q3TDV5 Q5DTZ1 
Human Ortholog
ENSG00000174705 (SH3PXD2B)
Omim not available
UniTrap UNI25567
Vector Insertion
Chr 11: 32247969 - 32271517
Public Clones IST13674B4 (tigm)
Private Clones OST176530 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038753
Sequence
GGTGGCGGCGGCGGCAAGTGCTCGGCGGCAAGGATCGCTTTGGCCCGGCCCGGCCCGCACGGCGCTGGGCGCGGAGAACGGCCATGCCGCCGCGGCGCAG

TATCGTGGAGGTGAAGGTGCTGGACGTGCAGAAGCGGCGCGTGCCCAACAAGCATTAT - UNI25567 - GTCTACATCATCCGAGTCACGTGGTCCA

GTGGCGCCACGGAGGCCATCTACCGGCGCTACAGCAAGTTCTTTGACCTCCAG ATGCAGATGTTGGACAAGTTCCCCATGGAAGGAGGACAGAAAGACC

CCAAGCAGAGGATCATTCCATTTCTGCCAG GCAAAATCCTCTTCCGCCGCAGCCACATCCGGGACGTAGCCGTCAAACGCCTGATACCAATTGATGAAT

ATTGTAAG GCCCTGATCCAGCTGCCCCCCTACATCTCTCAGTGTGATGAGGTTCTGCAGTTTTTCGAGACAAGACCTGAGGACCTGAATCCTCCCAAAG

A GGAGCATATTGGGAAGAAGAAATCAG GGAATGACCCGACCTCAGTGGACCCTATGGTCCTGGAGCAGTATGTGGTAGTGGCAGACTATCAGAAGCAG

GAGAGCTCAGAGATCAGCCTCAGTGTGGGCCAAGTAGTGGACATCATTGAGAAGAATGAGTCAG GTTGGTGGTTCGTCAGCACTGCTGAAGAGCAGGGC

TGGGTCCCTGCAACCTGCCTGGAAGGCCAGGATGGCGTGCAAGATGAGTTCTCCCTCCAGCCTGAGGAAG AGGAGAAATATACGGTCATCTACCCGTAC

ACAGCTCGTGACCAGGATGAAATGAACCTAGAGCGAGGGGCTGTGGTGGAGGTCGTCCAGAAGAACCTGGAGGGCTGGTGGAAGATCAG GTACCAGGGC

AAAGAGGGCTGGGCCCCTGCTTCCTACCTAAAGAAGAACAGTGGGGAGCCCTTGCCCCCAAAGCTTGGCCCCAGCTCACCTGCTCACTCGGGTGCCCTCG

ACCTGGATGGTGTTTCCCGGCATCAGAATGCTATGGGCAGGGAGAAGGAGCTGCTGAACAACCAGAGGGATGGCCGGTTTGAAGGTCGCCTGGTGCCCGA

TGGTGACGTTAAGCAGA GATCACCAAAGATGAGGCAAAGACCCCCTCCTCGCCGAGACATGACCATT CCTCGAGGCCTCAACCTGCCGAAGCCCCCCA

TCCCACCCCAGGTGGAGGAAGAGTACTACACCATCGCTGAGTTCCAGACCACCATCCCAGATGGCATCAGCTTCCAGGCGGGCCTGAAGGTGGAG GTGA

TTGAGAAGAGCCTAAGTGGTTGGTGGTACATTCAGATGGAAGATAAGGAGGGGTGGGCCCCAGCGACCTTCATTGACAAGTATAAGAAGACCAGCAGTGC

CTCGAGGCCCAACTTTCTGGCCCCCTTGCCTCATGAGATGACCCAGCTCCGGCTTGGGGATGCAGCTGCAACAGAGAACAATACGGGTCCAGAAGCCGTG

GGGCCCTCCAGACCCCTGCCTGAGGCACCACACGGTGCTGTGGACTCTGGGATGCTCTGGTCCAAAGACTGGAAAGGAGGAAAAGAGGCCCCAAGAAAGG

CATCTTCAGACCTGTCTGCGTCAACAGGATATGAGGAGATCTCGGACCCCACACAGGAGGAGAAGCCCAGCCTCCCTCCACGCAAAGAGTCCATCATCAA

GTCTGAAGAGGAGTTGCTGGAGAGGGAAAGACAGAAGATGGAGCCGCTCCGGGGCTCCTCCCCCAAGCCCCCTGGCATGATATTGCCAATGATTCCAGCA

AAGCATGCCCCGCTGGCCCGGGACAGCAGGAAACCAGAGCCCAAACTTGACAAGAGCAAGTTCCCGCTGAGAAATGACATGGGGTTAGAGTGTGGCCACA

AGGTGCTGGCCAAGGAAGTGAAAAAGCCCAACCTCCGGCCCATCTCCAGGTCTAAAGCTGAGCTGTCCGAGGAGAAGGTGGACCCCACCTCCCAGAATCT

GTTCATGAAGTCTAGACCTCAGGTTAGGCCCAAACCAACTCCTTCCCCCAAGACAGAGCCAGCTCAGAGTGAAGACCACGTGGATATCTACAACCTCAGG

AGCAAGCTCAGACCTGCCAAGTCTCAAGAGAAAGCCTTATTGGATGGAGAAAGCCACCATGCTGCTGGGAGCCATGACACAGCCCTCAGCAGAAGCTTCC

TTCCCGGGGAGGGACCTGGCCATGGCCAGGACAGGTCTGGCAGACAGGATGGGCTGAGTCCAAAGGAGACACCCTGCAGAGCCCCTCCCAGGCCAGCCAA

GACCACAGACCCTGGGCCCAAGAATGTGCCTGTGCCTGTCCAAGAAGCAACCCTGCAGCAAAGACCTGTGGTCCCACCTCGAAGACCCCCACCCCCCAAG

AAAACCTCCTCGTCACCACTGTCGTGCAGGCCCCTTCCAGAGGTCAGAGGGGCACAGCGTGAAGAAAGCAGAGTCGCTCCTGCTGCAGGCCGGGCCCTCC

TTGTCCCTCCAAAAGCCAAACCCTTCCTCTCTAACTCCTCAGTGGGCCAAGATGACATGCGAGGCAAAGGTGGGCTGGGGCCACGCGTCACTGGCAAGGT

GGGAGAAACCAGAGAGAAGGCGGCTTCCTTCCTCAATGCCGATGGCCCAAAGGACTCACTTTACGTGGCCGTGGCCAACTTTGAAGGAGATGAAGACACC

AGCAGCTTCCAGGAAGGGACAGTGTTTGAAGTCCGGGAGAAGAACAGCAGTGGCTGGTGGTTCTGCCAGGTCCTCAGTGGGGCTCCTTCCTGGGAAGGCT

GGATTCCTTCCAACTACCTCCGGAAGAAACCCTAGCTTCCCCGCCCTGCCGGGAGGCCCAGCAGTCCCTGCTAGCCTTCCCCACGTATTTAATACGCATC

TTAATTTATCAGTCTCCACATCATTTCGAGGAAGGTGGCCATTGGGATGCTGTGATATCCTGTAGCCTGGGGTCTGATTCTCCTGTTGTGGCTTCTCCAG

AAGTCTCAAAAGCCACAGCCTTTGCCAGGTAGAAACCACGTTACCATCCTTGTCTGTGGTAGAACCCATCCTCATAGGCAACATCTTGTTATCCAGAAGC

AGGATAGTGACACAGACCCCCAGAACTGACACCAGCCACCTGGAAGACTTCCAGACCACCCTCAATGCTCAATTTGGCATAGAGGGACAGCCTCACAGCC

TGTGACAACTCGCTCTAACTTCTCCATGTTACCAGAAGCCCAGTCATGGCTTTGTTCACCGTTCTCAGAATACCTGGTGCCAGGAAGAACCGAGTCCCGA

AAGAATCAGCCTCCGGGGTTTCTGCTTCTAAGTCCTGAGCAGCTGCAGCTGCCCTCAAGTGGTCCTAGAGATTCACTCGGTTATCCTGCCTTGGACCGTG

ATCAGTCCTAAAGGAGCACGCTTCACTTCACTGCTAAAGCCACTGGTCCATTCAGGGCTTTTAAATTCCAATTCCCACCCACCTCCCTCAGTCCCTGGAA

CAAGAGTCTCCACGTTTGTTTAAGTAAGGGGCCAGTCCTTCACAAGGCACATGGTCCATGAGTGCTTCTTTGCCTAGTAGGTGCCAAACTGCCCTTGGCC

TTCTGCCTTCAGGTTCTGTCAACCAGGCTCCCTCCCCTGTCTATTGCACCCATTTTCTAGTTGAGGAAAGTGAGGCTCTACAGGCCCCAGGATATGCTAG

GTAGGAAGTGGCTGAAGGAGGCTTGAGTCCAGGTCTGCCTGACCCCAGTATCCATGCTCTTCTCCCTGCAAGAACAACCAGAGAGGGAAGAGATGGAGGT

TGACTGGGTATCAGGGTAGGTGGCCTGGGGGCTTCCTTATGTTATGAGCAAAGGGATGGTAGTGACTGCCCTGGACTCACAGCTGTCTCTGCAGGACAGG

GTGTACCCTGGATCCTTAGTAGCAGTTACAAAGCTTATAGCCTGATACCCTGTGTGTGGAAGAGAAATAAAGGAAGCCGAGGCACTGTCCCTCTGGTGGC

TAAGGACCAGCAGCTTGGTCTGTGCCAAACTAAGAACAGTACCCAAGGGCCTGTAGTGTCCTGCCCCAGCAGCAGCTGCTGCTCCGTGTAGAACAGTTGG

CTTTTTAGCGTGCTCTTTCCCTGGGAGAAGCCCAGGGTAGCCCTTCCCTATTTTGACCAATAGACGGCTAAGGCCTGGAGAGGTCCACTTAGTTATTGCA

GAGCTAAAAATCAGGACCCAGATTTCTAGCTCCCAGCCCAGACCAACTTGTACCTATGAATGGGCTTCCTGTGAAAGCGGGGTAGGGTTGGGAGGGCCAA

GCTCCATCCCATCCCACAGTCCCTACAGAAGAGGGGACAGCCCTGTCTGGTTCTACACTTCCCCAGTGTTCATTTTTAATGTGGTTTGGAAACCACGAAG

CCCCCTTTCCCAAGATGCTTGCATCTTACTTGCAGTGCCAAAGATTTTGTGCAAGGGGATCCTTTCTGCACCCCACCCCTGCCCAACTCTCTCTGCTTTC

CTCTGACCCACCTGGCGCTGTCACTCTCTTCCTCTGTTCAGCCTGCAGTCCCCTACGCCCCACCCCCACCCCCCAGCACTGGGCCTGGGTAGGAGGCACC

TGAAGGATGACCCTGCTTAGTCTGTGCCCTGGGCCTCGGGGGAAAGCGGCAGTTAGGGAGAGGGGAAGCTGAGAGAGTCTTCAGCTCTGGAGCAGCACTT

GAGAGCCTCATGCCCACACCCACGCTGTGCAGGAATCCTCATAGCTTTCTATTTGTTGGTGGTTTTTGAGTTTCGACACCTCTGCTTGACCAGCTTTCTG

AAGCCGTTTTACAGGCCTTTGGTTGTTGCTGTTTTGTTTTTCCTGCTTGCACTTGGCTCTCTGTGACCTTCTCAAGTATTTTACAAGTCCCTTCTATGCC

GCAGATGCTGGGTAGACCAGGGAGCGGGGAGGGGGGCATCACCCTGCACTGAAGAACTGAGCTTTGCCCACTAGCTCCAGTGAAGAAGTCATCTGCCTTC

TACCCTCCTCTCTGGTCAGCTGAGGCAGAGCAGACAGGCCTTCCTGTGGGCAATGAGAGAATTTACCTTTTGTCCTATCCTTGTGCTGCTGTGAACTGTA

TGTGTGCCGGGTTCCCTTTCTGTTCACTGTCTTTTTCTTGGGTCACACACACAGTCTGAAGGTTTCTGTGGCAAGCTCCATCGGCCATAGTGCTTCATCA

CTAGCCTGGGCAACCGGAAGCGAGTGGGTCTGCAGAGCCAAGTCACTCACCCAATTTCCCTTGCCTGGGACTTAGCTTTTCAACATCCAGGACTGTGGTC

ACTCCTGTCGGGATGGAGCATATATGCCAGACTCCCCCTCACCCCCCATCCCTGCCTACTTCCAAGGCCAGGGTAGCAATGTCTGGGCCAATCACAGATC

AGATCACCGACACAAACTTGTGCCCCTCCCCTGCAACTAACATTCACATCAACTCTGTTGATGTGATGGCAGGGACCACCTCAATACATAATGGGAAAGT

TAAGGTATGGAGAGTGAAGTCACATCCTGCCTTGTTCAGGTTCGGGCCACCAGCAAAGAAATGTTACAGTTCTGATTTTAGGTGTCTCTCCCTCAATCCC

CTGACCAAACATTGGTCATTGACCAGATGGCCCCTCTTGGATGAACCCTGCTCTCTGGCTCCATGGTTGCATTGTTTCTGCCTGAGAGTAAGTATAGTAC

CCTGCCTCTGGAAACCTGGGCTTGAAAACAGCCATTGCTAGATGGAAACTTTGCTTATATTTTCTGGCCAGAGTCACTCTTGGCCATTTATGTTAATACC

ATGGCTCCCGGCTGAGGCCAGGGGTGGTCTGTGCTCCAGCTACTTCTAGTCCTGCCAGGAAATGGCAAGAGCCATGCTAGGCGCTCACAGGCGGGGTGTT

TTGTTTTGTTTTGTTTTGTTTTGTTTTTGAGCCTCTGCCACCAGACCGCCCCATAGAGTTGATTTCTATGGCACAGTTCTTGACCTTAAACTGTCTCTGA

ACCCACTGGGGACTTGGGGAGTGGATGGAAAGTGGGGATACATGTGCTTCACTAAAGAACAGGTGCCAAATCTCCCCACAAGAACTTAGGACAGACAGTC

TAGTGTTTATCGCCAAATTCTGGCCCTTAGTGAGAGGAAGAAACTGACCATCTAAGGAGAGTGGTGTGGAGTTGTGGTGCAGCCAGAAAGCAATGGCCCG

AATGTGTGGGCCCCAGGCTCCATCCCCAGCATCACAGATAAACAAGAACCTTAATGGCTTAGCTCCTGTCCTTCCATTGAGCCCAGGGCTCTTCAGTGTC

GACATAGTCCATACCCTGGGAAGCCTTGCCATTTCTTTGAACAGTGTGGCCATCTCGGCCCCTTCGGTGGCTGTCTAAACTTTCCTTCAGGGTTTTTCCT

GTATACTATGGACAGCCATATCCTACCACAGACCAAAGATTCCCTGAAGTCAGAGGGGTGTGGACTGAATGGGTAGAAAATTAATTTGTATCAAGGCCCA

AGGGTTTGCCTTTGCCTGGAAGAATTGCTCCTAACTTGCTAAGGTTCTAGCAGCAGGACTGACCTGACCCCAAGCAGAGCTGTACAGTTAAGACAATGGT

TCGTACTCCTCACCTCCTGGACAACCGTCCCACAGACCAGACCTTCCTGCTCTAGGGAGTGATGCTTGGTCCCCGGTGCTATCTAGTTGAGGTACCAAGC

CCCTCAAATGTGAGGGTTCCATCTTCTTCCCTGTCTCTGTACTCCTTCCCCAAGGAAGCCCTCTTAGCTCCCATCAGAATGAGGGCTTAGCTTCTGTCCT

TCAAAAGACCAGACCCGGTGCCATCGCCAGTGGCCTTCCCTCTCACCTCTGCTTTTAAGAGCAAAGGTGCCCTGCCAGGCTTATTACAGCAATAAACAAT

TCTAATGCAATGGAGGTGTCCGGATTATGCCTGCAATGCCTTTGTGCCCTGTAATTACTAGTAGCACCTCTCGTACATACCAGAGAGTGTGATAAACTGT

GGTCACCTTAGCCATACATGGTTCCTGTTTCGGGGCCACTGAGGTTGCTTCTAACATCCCTCCAGAAACAGTGGGCTCTAGACAGCGTGGCCCACTGTAT

TCATGGGCCCACAGCTGGTGCTGGGAACCCCTGGGTTCTCAGCCCTTCTCACACCCCCTAGGCCAACTGACAGGTCCTGGTGGTGGCTTTTATCTCCCGT

GAGTGTTTAATGTGAGGGGGCAGGGGATGAACACCTAGCTGTAGCATGTAGAGACTGTATACCATTAGTCTTTTCTTTTTTAAAATAATAAAATGCTTGA

CTGGTTTCAAGCTTCGTTGTAAAGATGTAGTGTTTGTGGATTTCATCTGGCTGAAAGAGATACATGCCCCGGTGTCTGGACTTCATGCGTTGGTGTCTGC

ACTTGAGCTCTTTGTGTCTGAAGAAGAGAAATAAACAGAATCTGTTCAAGCATTGCC
Translation
MPPRRSIVEVKVLDVQKRRVPNKHY - UNI25567 - VYIIRVTWSSGATEAIYRRYSKFFDLQ MQMLDKFPMEGGQKDPKQRIIPFLPG GKILFR

RSHIRDVAVKRLIPIDEYCK ALIQLPPYISQCDEVLQFFETRPEDLNPPKE EEHIGKKKSG GNDPTSVDPMVLEQYVVVADYQKQESSEISLSVGQV

VDIIEKNESG GWWFVSTAEEQGWVPATCLEGQDGVQDEFSLQPEEE EEKYTVIYPYTARDQDEMNLERGAVVEVVQKNLEGWWKIR RYQGKEGWAPA

SYLKKNSGEPLPPKLGPSSPAHSGALDLDGVSRHQNAMGREKELLNNQRDGRFEGRLVPDGDVKQR RSPKMRQRPPPRRDMTI PRGLNLPKPPIPPQV

EEEYYTIAEFQTTIPDGISFQAGLKVE VIEKSLSGWWYIQMEDKEGWAPATFIDKYKKTSSASRPNFLAPLPHEMTQLRLGDAAATENNTGPEAVGPSR

PLPEAPHGAVDSGMLWSKDWKGGKEAPRKASSDLSASTGYEEISDPTQEEKPSLPPRKESIIKSEEELLERERQKMEPLRGSSPKPPGMILPMIPAKHAP

LARDSRKPEPKLDKSKFPLRNDMGLECGHKVLAKEVKKPNLRPISRSKAELSEEKVDPTSQNLFMKSRPQVRPKPTPSPKTEPAQSEDHVDIYNLRSKLR

PAKSQEKALLDGESHHAAGSHDTALSRSFLPGEGPGHGQDRSGRQDGLSPKETPCRAPPRPAKTTDPGPKNVPVPVQEATLQQRPVVPPRRPPPPKKTSS

SPLSCRPLPEVRGAQREESRVAPAAGRALLVPPKAKPFLSNSSVGQDDMRGKGGLGPRVTGKVGETREKAASFLNADGPKDSLYVAVANFEGDEDTSSFQ

EGTVFEVREKNSSGWWFCQVLSGAPSWEGWIPSNYLRKKP

For any suggestions or comments, please send an email to unitrap@crg.es