Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040720 (1110037F02Rik)
Chromosomal location
Chr 4: 11413105 - 11478290 (+)
Description
RIKEN cDNA 1110037F02 gene Gene [Source:MGI Symbol;Acc:MGI:1913435]
RefSeq_dna
NM_001081183 
RefSeq_peptide
NP_001074652.1 
UniGene
Mm.331487 
MGI
MGI:1913435 
Uniprot/SWISSPROT
A2AIV2 
Uniprot/SPTREMBL
Q8CFK9 
Human Ortholog
ENSG00000164944 (KIAA1429)
Omim not available
UniTrap UNI23032
Vector Insertion
Chr 4: 11413253 - 11421910
Public Clones not available
Private Clones OST278488 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6684
Vector Insertion
Chr 4: 11428505 - 11432588
Public Clones BGC389 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3080
Vector Insertion
Chr 4: 11435327 - 11440174
Public Clones DC0225 (sanger) YTC430 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1825
Vector Insertion
Chr 4: 11446562 - 11448251
Public Clones BC0251 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6783
Vector Insertion
Chr 4: 11448407 - 11449999
Public Clones YHA427 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3661
Vector Insertion
Chr 4: 11450083 - 11453493
Public Clones CC0708 (sanger)
Private Clones OST317347 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21419
Vector Insertion
Chr 4: 11453741 - 11454287
Public Clones not available
Private Clones OST331139 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32052
Vector Insertion
Chr 4: 11455031 - 11455684
Public Clones IST11908H9 (tigm) IST10908B2 (tigm) IST12590D12 (tigm) IST12080D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18157
Vector Insertion
Chr 4: 11455938 - 11457974
Public Clones IST12590D12 (tigm) IST10830C9 (tigm) IST11849G11 (tigm) IST14485C5 (tigm)
IST10690G9 (tigm) IST12984B6 (tigm)
Private Clones OST428929 (lexicon) OST330483 (lexicon) OST37151 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25105
Vector Insertion
Chr 4: 11458193 - 11461335
Public Clones IST12865A6 (tigm)
Private Clones OST195054 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4311
Vector Insertion
Chr 4: 11461469 - 11467056
Public Clones AG0130 (sanger) XL241 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37039
Vector Insertion
Chr 4: 11472145 - 11473115
Public Clones CMHD-GT_501A3-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5873
Vector Insertion
Chr 4: 11473448 - 11475877
Public Clones CSH053 (baygenomics) IST14685G4 (tigm)
Private Clones OST470285 (lexicon) OST309935 (lexicon) OST84114 (lexicon) OST56031 (lexicon)
OST26937 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16455
Vector Insertion
Chr 4: 11476022 - 11476691
Public Clones IST12338C12 (tigm) IST10855F2 (tigm) IST14923H6 (tigm)
Private Clones OST460873 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055372
Sequence
AGTTTTCCCCCTAGCTGGAGCCTCGGCCTGGGAGGTTGGAGAGCTGCCCCGGAAGTCATCTCCCGGTCCCCCGCCCGCGGCAGACATGGCGGTGGACTCG

TCTATGGAGCTGCTATTTTTAGATACTTTTAAACATCCGAGCGCTGAG - UNI23032 - CAAAGTTCTCATATAGATGTGGTTCGTTTTCCGTGTGT

GGTTTATATCAATGAAGTCCGAGTTATACCCCCGGGAGTACGAGCCCATAGTGGCTTACCTGACAACAGAGCATATGG GGAAACATCTCCTCACACATT

TCAACTTGACTTATTCTTCAATAATGTAAGCAAACCAAGTGCTCCAGTTTTTGATAGGTTGGGAAG CCTGGAATATGATGAGAATACGTCTATCATCTT

TAGACCAAACTCGAAG - UNI6684 - GTAAATACTGATGGTCTGGTACTAAGAGGCTGGTACAACTGTCTGACCCTGGCAATATATGGATCGGTAGA

TAGAGTGATAAGCCATGACAGAGACTCTCCACCACCTCCACCTCCACCTCCACCTCCTCCCCAGCCACAGCCGACTTTGAAAAGGAATCTAAAGCATG C

TGATGGTGAGAAGGAAGATCAGTTTAATGGAAGTCCTCCAAGACCCCAGCCACGGGGACCAAGAACTCCTCCTGGACCTCCTCCACCTGATGACGATGAG

GACGACCCTATGTCTTTGCCAG TGTCTGGTGACAAAGAAGAGGATGTTCCCCATCGAGAAGATTACTTTGAGCCCATTTCTCCTGATAGGAATTCTGTC

CCGCAGGAAGGTCAGTATTCCGATGAAGGAGAGGTAGAAGAGGAACCGCAAGAAGAGGGAGAAGATGATGAAGATGATGTGGATGTAGAGGAAGAAGAGG

ATGAAGATGAGGATGACTGCCATACAGTAGATAGTATCCCTGATGATGAGGAAGAAGATGAAGAGGAAGAAGGTGAAGAGGATGAAGAAGGTGAAG - U

NI3080 - GGGACGATGGCTACGAGCAGATCTCTAGTGATGAAGATGGAATTGCTGACTTGGAACGTGAAACATTCAAGTATCCAAACTTCGATGTTGA

GTATACTCCAGAAGACCTGGCATCTGTCCCTCCTATGACGTATGACCCGTATGACAGGGAGCTGGCACCACTCTTGTATTTCAGCTGTCCATACAAAACT

ACTTTTGAAATTGAAATCAGTAGAATGAAGGATCAAGGTCCAGATAAAGAGAATTCAGGGGCAGTAGAAGCCTCGGTGAAGTTAACTGAACTGCTAGACC

TGTATCAGGAAGACAGGGGTGCAAAGTGGGTGACGGCTCTAGAAGAAATTCCAAGTCTAATTATAAAAGGATTAAGCTATTTGCAATTGAAAAACACAGA

ACAAGACTCCCTTGGCCAGTTGGTAGACTGGACAATGCAAGCTTTAAATTTACAAGTAGCCTTTCGACAGCCCATAGCCTTAAATGTCCGACAGCTCAAA

GCTGGGACCAAGCTAGTGACCTCATTAGCAGAATGTGGGGCTCCAGGAGTCACAGAATTGCTACAAGCAGGAGTGATCAATGTATTGTTTGATCTCTTAT

TTGCTGATCATGTCTCATCTTCCCTTAAGTTAAATGCTTTTAAAGCTTTGGACAGTGTCATTAGCATGACAGAAGGAATGGAGGCTTTTTTAAGAAGCAC

CCAAAATGAGAAAAGTGGCTATCAAAGACTTCTGGAACTCATACTTCTGGATCAGACTGTGAGGGTTGTCACTGCTGGCTCAGCTATTCTTCAAAAATGC

CATTTCTATGAAATCTTGTCAGAGATTAAAAGACTTGGTGACCACATAGCAGAGAAGACTTCAGCTGTTCCTAACCACAGTGAGCCTGACCAGGACACAG

ATGCTGTGCTGGAGAGAGCAAATCCCGATTATGAGAATGAAGTAGAAGCTTCTATGGACATGGATCTTTTGGAGTCCTCAATTATAAGTGAAGGTGAAAT

AGAAAAGCTTACTAATCTCTTAGAGGAGGTTTTTCATGTCATGGAAACTGCACCTCATACAATGACCCAACCTCCTGTCAAGTCTTTCCCCACAATAGCC

CGGATTACCGGGCCTCCAGAGCGGGATGACCCGTACCCTGTCCTCTTTAG GTATCTTCACAGCCATCACTTCCTGGAGTTGGTCACCTTGCTTCTGTCG

ATTCCAATAACAAGTGCCCATCAGGGTGTACTGCAAGCCACGAAGGATGTTTTAAAGTTTCTTGCACAGTCACAAAAGGGCCTTCTCTTTTTTATGTCAG

AATATGAAGCGACAAACTTGTTGATCCGAGCTCTGTGCCACCTTTATGATCAAGACGAAGAGGAAGGCCTTCAGTCTGATGGGGCTGATGATGCCTTTGC

CTTGTGGCTGCAGGACTCAACTCAGACTCTGCAGTGCATCACAGAGCTGTTCAGCCATTTCCAGCGGTGTACAGCCAGTGAAGAAACTGACCATTCTGAT

CTCCTGGGCACCCTCCACAATCTTTACTTGATTACTTTTAACCCTGTGGGAAGATCAGCTGTTGGCCATGTTTTCAGCCTTGACAAAAACCTTCAAAGTC

TCATTACTCTAATGGAGTACTATTCCAAAGAAGCCCTAGG - UNI1825 - CGATTCCAAGTCTAAGAAGTCAGTAGCTTATAATTACGCATGCGTAC

TCACGCTGGTGGTGGCTCAGTCTTCCAGCGGTGTCCAGATGTTAGAACAGCACGCAGCATCGCTCTTGAAGCTCTGCAAAGCAGATGAAAATAATGCGAA

ATTGCAAG - UNI6783 - AACTTGGCAAATGGCTTGAACCTCTGAAAAACCTCAGATTTGAAATTAACTGCATCCCAAATCTAATTGAATATGTTAA

ACAG - UNI3661 - AATATTGATAACTTGATGACTGCAGAAGGAGTTGGCCTTACCACTGCCTTACGTGTTCTCTGTAATGTGGCATGTCCACCACC

TCCCGTAGAAG - UNI21419 - GTCAGCAGAAAGACCTGAAATGGAACCTTGCTGTTATTCAGCTTTTTTCTGCTGAAGGAATGGACACCTTTATTC

GGGTTCTGCAAAAACTGAACAGTATTTTGACGCAGCCTTGGAGGCTCCATGTGAACATGGGGACTACCCTGCACAGAGTCACTACCATTTCAATGGCTCG

CTGCACGCTCACTCTGCTTAAAACTATGCTGACAGAGCTCCTGCGAGGCGGATCCTTTGAGTTTAAGGACATGCGTGTTCCTTCAGCACTTGTTACTTTA

CACATGCTCCTGTGCTCTATCCCTCTCTCAGGTCGTTTGGATAGTGATGAGCAGAAAATTCAGAATGATATCATAGATATCTTACTGACTTTTACACAAG

GAGTCAATGAGAAGCTCACGATCTCGGAAGAGACTCTGGCCAATAATACTTGGTCTTTAATGTTAAAGGAAGTTCTCTCTTCCATCTTGAAGGTTCCGGA

AGGCTTCTTCTCAGGACTCATACTCCTTTCAGAGCTGCTGCCTCTTCCCTTGCCCATGCAGACCACGCAGGTACCACTTCATATCACATGCATCTTGTCA

TGACTGCAGTAGCTCCTTAGTAATGCCAGGGATGCTGGTCAAACCCAAGCAAGCCTTCGTCCTCCTCCCCAAAGACAGAGTAACTGAGCTGAGGGTGAGA

TGAAACTGAAGCGAGTTGGAAGTGTGGGGTAATGTTTGAAATGCCTTTTGTGAAGCGAGTTTTATCATGTTGTTATGTATACTTGTACTTATGTTTTCCT

GTTACTGCAAATCTTTTTTCTCCCCTTATCATGTTTTTAGAATTTGCAAATTAGATCGCTTCATCAATGGACTCTGCTCAACTGACTGCCAACCTGAGAA

CAATACTTTTTTTTAGACCTGTTGGATTCAAACAATTGTTTAATTGTAATAGTGTAATAGTGAATTATGTTTTAAGCATGCAGTAAAGGTGTTCTTTTTA

TGACAGTTCTTCCTGAACAGTTTTGCGACTATAATAAAAAAAAAATCTATGT
Translation
MAVDSSMELLFLDTFKHPSAE - UNI23032 - QSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYG GETSPHTFQLDLFFNNVSKPSAPVF

DRLGS SLEYDENTSIIFRPNSK - UNI6684 - VNTDGLVLRGWYNCLTLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPTLKRNLKHA ADGEKE

DQFNGSPPRPQPRGPRTPPGPPPPDDDEDDPMSLPV VSGDKEEDVPHREDYFEPISPDRNSVPQEGQYSDEGEVEEEPQEEGEDDEDDVDVEEEEDEDE

DDCHTVDSIPDDEEEDEEEEGEEDEEGEG - UNI3080 - GDDGYEQISSDEDGIADLERETFKYPNFDVEYTPEDLASVPPMTYDPYDRELAPLLYF

SCPYKTTFEIEISRMKDQGPDKENSGAVEASVKLTELLDLYQEDRGAKWVTALEEIPSLIIKGLSYLQLKNTEQDSLGQLVDWTMQALNLQVAFRQPIAL

NVRQLKAGTKLVTSLAECGAPGVTELLQAGVINVLFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFLRSTQNEKSGYQRLLELILLDQTVRVVTAGS

AILQKCHFYEILSEIKRLGDHIAEKTSAVPNHSEPDQDTDAVLERANPDYENEVEASMDMDLLESSIISEGEIEKLTNLLEEVFHVMETAPHTMTQPPVK

SFPTIARITGPPERDDPYPVLFR RYLHSHHFLELVTLLLSIPITSAHQGVLQATKDVLKFLAQSQKGLLFFMSEYEATNLLIRALCHLYDQDEEEGLQS

DGADDAFALWLQDSTQTLQCITELFSHFQRCTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFSLDKNLQSLITLMEYYSKEALG - UNI1825 -

 GDSKSKKSVAYNYACVLTLVVAQSSSGVQMLEQHAASLLKLCKADENNAKLQE - UNI6783 - ELGKWLEPLKNLRFEINCIPNLIEYVKQ - UN

I3661 - NIDNLMTAEGVGLTTALRVLCNVACPPPPVEG - UNI21419 - GQQKDLKWNLAVIQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMG

TTLHRVTTISMARCTLTLLKTMLTELLRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLM

LKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVPLHITCILS
Transcript ENSMUST00000059914
Sequence
AGTTTTCCCCCTAGCTGGAGCCTCGGCCTGGGAGGTTGGAGAGCTGCCCCGGAAGTCATCTCCCGGTCCCCCGCCCGCGGCAGACATGGCGGTGGACTCG

TCTATGGAGCTGCTATTTTTAGATACTTTTAAACATCCGAGCGCTGAG - UNI23032 - CAAAGTTCTCATATAGATGTGGTTCGTTTTCCGTGTGT

GGTTTATATCAATGAAGTCCGAGTTATACCCCCGGGAGTACGAGCCCATAGTGGCTTACCTGACAACAGAGCATATGG GGAAACATCTCCTCACACATT

TCAACTTGACTTATTCTTCAATAATGTAAGCAAACCAAGTGCTCCAGTTTTTGATAGGTTGGGAAG CCTGGAATATGATGAGAATACGTCTATCATCTT

TAGACCAAACTCGAAG - UNI6684 - GTAAATACTGATGGTCTGGTACTAAGAGGCTGGTACAACTGTCTGACCCTGGCAATATATGGATCGGTAGA

TAGAGTGATAAGCCATGACAGAGACTCTCCACCACCTCCACCTCCACCTCCACCTCCTCCCCAGCCACAGCCGACTTTGAAAAGGAATCTAAAGCATG C

TGATGGTGAGAAGGAAGATCAGTTTAATGGAAGTCCTCCAAGACCCCAGCCACGGGGACCAAGAACTCCTCCTGGACCTCCTCCACCTGATGACGATGAG

GACGACCCTATGTCTTTGCCAG TGTCTGGTGACAAAGAAGAGGATGTTCCCCATCGAGAAGATTACTTTGAGCCCATTTCTCCTGATAGGAATTCTGTC

CCGCAGGAAGGTCAGTATTCCGATGAAGGAGAGGTAGAAGAGGAACCGCAAGAAGAGGGAGAAGATGATGAAGATGATGTGGATGTAGAGGAAGAAGAGG

ATGAAGATGAGGATGACTGCCATACAGTAGATAGTATCCCTGATGATGAGGAAGAAGATGAAGAGGAAGAAGGTGAAGAGGATGAAGAAGGTGAAG - U

NI3080 - GGGACGATGGCTACGAGCAGATCTCTAGTGATGAAGATGGAATTGCTGACTTGGAACGTGAAACATTCAAGTATCCAAACTTCGATGTTGA

GTATACTCCAGAAGACCTGGCATCTGTCCCTCCTATGACGTATGACCCGTATGACAGGGAGCTGGCACCACTCTTGTATTTCAGCTGTCCATACAAAACT

ACTTTTGAAATTGAAATCAGTAGAATGAAGGATCAAGGTCCAGATAAAGAGAATTCAGGGGCAGTAGAAGCCTCGGTGAAGTTAACTGAACTGCTAGACC

TGTATCAGGAAGACAGGGGTGCAAAGTGGGTGACGGCTCTAGAAGAAATTCCAAGTCTAATTATAAAAGGATTAAGCTATTTGCAATTGAAAAACACAGA

ACAAGACTCCCTTGGCCAGTTGGTAGACTGGACAATGCAAGCTTTAAATTTACAAGTAGCCTTTCGACAGCCCATAGCCTTAAATGTCCGACAGCTCAAA

GCTGGGACCAAGCTAGTGACCTCATTAGCAGAATGTGGGGCTCCAGGAGTCACAGAATTGCTACAAGCAGGAGTGATCAATGTATTGTTTGATCTCTTAT

TTGCTGATCATGTCTCATCTTCCCTTAAGTTAAATGCTTTTAAAGCTTTGGACAGTGTCATTAGCATGACAGAAGGAATGGAGGCTTTTTTAAGAAGCAC

CCAAAATGAGAAAAGTGGCTATCAAAGACTTCTGGAACTCATACTTCTGGATCAGACTGTGAGGGTTGTCACTGCTGGCTCAGCTATTCTTCAAAAATGC

CATTTCTATGAAATCTTGTCAGAGATTAAAAGACTTGGTGACCACATAGCAGAGAAGACTTCAGCTGTTCCTAACCACAGTGAGCCTGACCAGGACACAG

ATGCTGTGCTGGAGAGAGCAAATCCCGATTATGAGAATGAAGTAGAAGCTTCTATGGACATGGATCTTTTGGAGTCCTCAATTATAAGTGAAGGTGAAAT

AGAAAAGCTTACTAATCTCTTAGAGGAGGTTTTTCATGTCATGGAAACTGCACCTCATACAATGACCCAACCTCCTGTCAAGTCTTTCCCCACAATAGCC

CGGATTACCGGGCCTCCAGAGCGGGATGACCCGTACCCTGTCCTCTTTAG GTATCTTCACAGCCATCACTTCCTGGAGTTGGTCACCTTGCTTCTGTCG

ATTCCAATAACAAGTGCCCATCAGGGTGTACTGCAAGCCACGAAGGATGTTTTAAAGTTTCTTGCACAGTCACAAAAGGGCCTTCTCTTTTTTATGTCAG

AATATGAAGCGACAAACTTGTTGATCCGAGCTCTGTGCCACCTTTATGATCAAGACGAAGAGGAAGGCCTTCAGTCTGATGGGGCTGATGATGCCTTTGC

CTTGTGGCTGCAGGACTCAACTCAGACTCTGCAGTGCATCACAGAGCTGTTCAGCCATTTCCAGCGGTGTACAGCCAGTGAAGAAACTGACCATTCTGAT

CTCCTGGGCACCCTCCACAATCTTTACTTGATTACTTTTAACCCTGTGGGAAGATCAGCTGTTGGCCATGTTTTCAGCCTTGACAAAAACCTTCAAAGTC

TCATTACTCTAATGGAGTACTATTCCAAAGAAGCCCTAGG - UNI1825 - CGATTCCAAGTCTAAGAAGTCAGTAGCTTATAATTACGCATGCGTAC

TCACGCTGGTGGTGGCTCAGTCTTCCAGCGGTGTCCAGATGTTAGAACAGCACGCAGCATCGCTCTTGAAGCTCTGCAAAGCAGATGAAAATAATGCGAA

ATTGCAAG - UNI6783 - AACTTGGCAAATGGCTTGAACCTCTGAAAAACCTCAGATTTGAAATTAACTGCATCCCAAATCTAATTGAATATGTTAA

ACAG - UNI3661 - AATATTGATAACTTGATGACTGCAGAAGGAGTTGGCCTTACCACTGCCTTACGTGTTCTCTGTAATGTGGCATGTCCACCACC

TCCCGTAGAAG - UNI21419 - GTCAGCAGAAAGACCTGAAATGGAACCTTGCTGTTATTCAGCTTTTTTCTGCTGAAGGAATGGACACCTTTATTC

GGGTTCTGCAAAAACTGAACAGTATTTTGACGCAGCCTTGGAGGCTCCATGTGAACATGGGGACTACCCTGCACAGAGTCACTACCATTTCAATGGCTCG

CTGCACGCTCACTCTGCTTAAAACTATGCTGACAGAGCTCCTGCGAGGCGGATCCTTTGAGTTTAAGGACATGCGTGTTCCTTCAGCACTTGTTACTTTA

CACATGCTCCTGTGCTCTATCCCTCTCTCAGGTCGTTTGGATAGTGATGAGCAGAAAATTCAGAATGATATCATAGATATCTTACTGACTTTTACACAAG

GAGTCAATGAGAAGCTCACGATCTCGGAAGAGACTCTGGCCAATAATACTTGGTCTTTAATGTTAAAGGAAGTTCTCTCTTCCATCTTGAAGGTTCCGGA

AGGCTTCTTCTCAGGACTCATACTCCTTTCAGAGCTGCTGCCTCTTCCCTTGCCCATGCAGACCACGCAG - UNI21419 - GTTATTGAGCCACATG

ATATATCAGTGGCACTCAACACCCGAAAATTGTGGAGCATGCACCTTCATGTTCAAGCAAAGTTGCTCCAAGAAATAGTTCGTTCTTTCTCTGGCACAAC

CTGCCAGCCCATTCAACATATGTTACGGCGTATTTGTGTTCAATTGTGTGACCTTGCCTCTCCAACTGCTCTTCTGATCATGAGAACTGTGTTGGATTTG

ATTGTAGAAGACTTGCAAAG - UNI32052 - CACTTCAGAAGATAAAGAAAAACAGTATACTAGCCAAACCACCAGGTTGCTTGCTCTTCTCGATGC

CCTGGCTTCACACAAAGCTTGTAAATTAGCTATTTTGCATCTAATTAATGGAACTATTAAAGGCGATGAAAGATATGCAGAGATCTTCCAGGATCTTTTA

GCTTTGGTGCGCTCTCCTGGGGACAGTGTTACTCGCCAGCAGTGCGTGGAGTATGTCACATCCATTTTGCAGTCTCTCTGTGACCAG - UNI18157 -

 GACATTGCACTCATTTTGCCAAGCCCTTCTGAAGGTCCTGCCTCTGAGCTTGAACAGCTCTCTAACTCCCTACCAAGTAAAGAGCTGATGACTGCAATC

TGCGACTGTCTGCTGGCAACTCTAGCCAACTCTGAAAGCAGTTACAACTGTCTGCTGACATGTGTCCGTACAATGATGTTTCTTGCAGAGCACGATTATG

GATTGTTTCACCTGAAAAG - UNI25105 - CTCTTTAAGGAAGAACAGTAGTGCTCTGCATAGTTTGCTGAAGCGAGTGGTCAGCACATTCAGTAAG

GACACCGGTGAGCTTGCATCGGCGTCTCTGGACTTCATGAGACAGATCCTCAATGCTGATGCTATG - UNI4311 - GGCTGTTGTGGAGACGATAGT

GGTCTCATGGAGGTAGAGGGCGCTCACCCACCCCGGACGATGAGTCTTAACGCTGCAGAGTTAAAACAGCTCCTACAGAGCAAAGAAGAGAGTCCAGAGA

GTCTGTTCCTTGAACTAGAGAAGCTTGTTTTG GAACATTCTAAAGATGATGACAGTCTGGAGTCTTTGCTGGATAATGTAATTGGACTGAAGCAGATGC

TGGAGTCATCTGGTGAGCCTTTGCCTCTCAGTGACCAAGATGTAGAGCCAGTACTGTCAGCTCCAGAGTCTCTCCAGAATTTATTTAACAACAG GACTG

CATATGTGTTGGCTGATGTCATGGATGATCAGTTGAAATCTATGTGGTTTACTCCATTTCAGGCTGAAGAGATCGATACAGACTTGGATTTG GTAAAGG

TTGACTTAATTGAGCTTTCAGAAAAGTGCTGCAGTGATTTTGATTTGCATTCAGAACTAGAGCGCTCGTTTCTGTCAGAACCATCATCTCCAGGAAGATC

CAAGACTACTAAGGGATTTAAACTCGGGAAGCATAAGCATGAGACATTCATAACTTCAAG TGGAAAATCTGAATACATTGAACCTGCCAAACGAGCTCA

TGTTGTGCCGCCACCTAGAGGCCGGGGCCGGGGAGGATTTGGACAGGGCATACGGCCCCATGATATTTTCCGTCAGAGAAAGCAGAACACGAGCAGGCCG

CCATCTATGCACGTGGATGACTTTGTTGCAGCTGAAAGTAAAGAAGTGGTCCCTCAAGATGGAATACCCCCACCAAAACGGCCACTCAAAGTCTCACAAA

AGATTTCCTCTCGTGGTGGATTTTCAGGCAACCGAGGAGGACGGGGTGCTTTTCATAGTCAGAACAGGTTTTTCACACCGCCTGCTTCGAAAG - UNI5

873 - GAAACTACAGTCGTCGGGAAGGAACAAGAGGCTCGAGTTGGAGTGCTCAGAACACTCCTCGAGGAAATTATAATGAAAGCCGAGGGGGCCAGAG

CAACTTTAACAGGGGTCCTCTTCCACCATTACGGCCGCTTAGTTCTACGG - UNI16455 - GTTACCGCCCTAGTCCCCGGGATCGAGCTTCTAGAG

GCCGCGGGGGCCTGGGACCGTCCTGGGCTAGTACAAATAGCGGCAGTGGAGGCTCGAGAGGAAAGTTTGTTAGTGGAGGCAGTGGTAGAGGCCGTCATGT

ACGGTCCTTTACTCGATAGATGTGTTCTTGGCAACACCCCAAGTAAATGCACATTTCATGAGGACAAAAACAAACAGACCTTGAAGGACCAATTTAGACT

TAACAGTTATATCTGGATACATCTGAGAGAATATTTTTATCTGAAGAAAGCAGATTTTGTTTGATACTTAATGAGATTTCAATAAAAATCCAAACTTTGT

ACGTATGTTTGTATATATTTTTCCCATTTTATATGGTATTTATTTAGAAAGTTTCTAGGTAGAAAGAAAAAAACAATGATTTTTTTTTTTTGTATTTCTC

TTGCTTATACTATAGATATTTCCAAACTTTCTTAGCCTGTGACACCCTTTAGTGTGTCTCGGGAATTTTTTCACAGTATCCCTAGGCCAAAAACAAACTT

GATACTTTTGTTTATTGAACAGTTAGGGTCCAAGCAACTGAAGACTTTCCACCATCATCACCACTAGTAACTGGACACCGCTCAAGGCCTCACTCACCCT

TGGAAACAGCAGCCTTCCCTGTCCGGGTTTCCTGAGCAGTACTGTTTATCAAACTGCTGAATGGTCGTTACAAATGTGTGCTGTCCTGGAAAGTCACCCA

GTGTTACCCAGTGCTGAAAATGGGAACTACCTCAATTCATAGTTTGTGTGGTGCCCAGCAGATGTCGCTGTTTCCTCAGAAGTTTAAAACACTCATGCTA

ATTTACTAAGGTGCCCACCACACAATTTAGCAATCATTGCTGTACCAGAAGGAGCAAAAACTTCTTTATGTTAGAAGTACAGACTTTGCTTCAAGTTCGG

ACCTACTGATGCTATTTTATTATAGAGTTATTTAAAGCCTAAAAGTTGGCTTATCTTAATGCGGTTATTTTGGGAATCAGAAGCATCTACTTTATATTCA

GAAATAAAACTTATAACTTTGACCAAGGAGCCATATTTCCCCTAAGGTATGTCTTAATTCATTGAGCCTATATAAATGGCATAAAATATAGAGTTCTCTT

AAACAAAAATAAGTGTATGAGTCTCATTCCATCCTAACAGCCTCTATTTTGGGGAATCACTTGAGTGCATTTAATATATATTTATTAGGAAAAAAGGCCT

CGAAAAGTTCAGCTTTAGAATTGAGGGTTTAGCTTATTGATAGAAGTAGTTGCCTAGCATGTGTGATTAACTACTAGCAATGTTTCTGAGTGTGTGTGTG

TGAGCATGCACATGTGTACACATACATGTGCATGGAAATTTCAGATGGAAGGATTCTGATGTTTAAGTACAAGGTGATGAAAATCTTCTTACTATTCTGG

AACAACCCAAACTCTTAGTCTGCTCAGGCTGCTATAACATCATAAAATAGACTGGATGGCTTATATAAGAAGAAAATCTCACAGTTCCATTGGTCAGGCA

GTCGGTAAAAGCAGGCTCTGGGGAGGCACTCCTTGTAGACTTTTCACATGGGCTTTCTGTAGT
Translation
MAVDSSMELLFLDTFKHPSAE - UNI23032 - QSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYG GETSPHTFQLDLFFNNVSKPSAPVF

DRLGS SLEYDENTSIIFRPNSK - UNI6684 - VNTDGLVLRGWYNCLTLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPTLKRNLKHA ADGEKE

DQFNGSPPRPQPRGPRTPPGPPPPDDDEDDPMSLPV VSGDKEEDVPHREDYFEPISPDRNSVPQEGQYSDEGEVEEEPQEEGEDDEDDVDVEEEEDEDE

DDCHTVDSIPDDEEEDEEEEGEEDEEGEG - UNI3080 - GDDGYEQISSDEDGIADLERETFKYPNFDVEYTPEDLASVPPMTYDPYDRELAPLLYF

SCPYKTTFEIEISRMKDQGPDKENSGAVEASVKLTELLDLYQEDRGAKWVTALEEIPSLIIKGLSYLQLKNTEQDSLGQLVDWTMQALNLQVAFRQPIAL

NVRQLKAGTKLVTSLAECGAPGVTELLQAGVINVLFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFLRSTQNEKSGYQRLLELILLDQTVRVVTAGS

AILQKCHFYEILSEIKRLGDHIAEKTSAVPNHSEPDQDTDAVLERANPDYENEVEASMDMDLLESSIISEGEIEKLTNLLEEVFHVMETAPHTMTQPPVK

SFPTIARITGPPERDDPYPVLFR RYLHSHHFLELVTLLLSIPITSAHQGVLQATKDVLKFLAQSQKGLLFFMSEYEATNLLIRALCHLYDQDEEEGLQS

DGADDAFALWLQDSTQTLQCITELFSHFQRCTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFSLDKNLQSLITLMEYYSKEALG - UNI1825 -

 GDSKSKKSVAYNYACVLTLVVAQSSSGVQMLEQHAASLLKLCKADENNAKLQE - UNI6783 - ELGKWLEPLKNLRFEINCIPNLIEYVKQ - UN

I3661 - NIDNLMTAEGVGLTTALRVLCNVACPPPPVEG - UNI21419 - GQQKDLKWNLAVIQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMG

TTLHRVTTISMARCTLTLLKTMLTELLRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLM

LKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQ - UNI21419 - VIEPHDISVALNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQPIQHMLRRI

CVQLCDLASPTALLIMRTVLDLIVEDLQS - UNI32052 - STSEDKEKQYTSQTTRLLALLDALASHKACKLAILHLINGTIKGDERYAEIFQDLLA

LVRSPGDSVTRQQCVEYVTSILQSLCDQ - UNI18157 - DIALILPSPSEGPASELEQLSNSLPSKELMTAICDCLLATLANSESSYNCLLTCVRTM

MFLAEHDYGLFHLKS - UNI25105 - SSLRKNSSALHSLLKRVVSTFSKDTGELASASLDFMRQILNADAM - UNI4311 - GCCGDDSGLMEVE

GAHPPRTMSLNAAELKQLLQSKEESPESLFLELEKLVL EHSKDDDSLESLLDNVIGLKQMLESSGEPLPLSDQDVEPVLSAPESLQNLFNNR RTAYVL

ADVMDDQLKSMWFTPFQAEEIDTDLDL VKVDLIELSEKCCSDFDLHSELERSFLSEPSSPGRSKTTKGFKLGKHKHETFITSS SGKSEYIEPAKRAHV

VPPPRGRGRGGFGQGIRPHDIFRQRKQNTSRPPSMHVDDFVAAESKEVVPQDGIPPPKRPLKVSQKISSRGGFSGNRGGRGAFHSQNRFFTPPASKG - 

UNI5873 - GNYSRREGTRGSSWSAQNTPRGNYNESRGGQSNFNRGPLPPLRPLSSTG - UNI16455 - GYRPSPRDRASRGRGGLGPSWASTNSG

SGGSRGKFVSGGSGRGRHVRSFTR
Transcript ENSMUST00000108307
Sequence
AGTTTTCCCCCTAGCTGGAGCCTCGGCCTGGGAGGTTGGAGAGCTGCCCCGGAAGTCATCTCCCGGTCCCCCGCCCGCGGCAGACATGGCGGTGGACTCG

TCTATGGAGCTGCTATTTTTAGATACTTTTAAACATCCGAGCGCTGAG - UNI23032 - CAAAGTTCTCATATAGATGTGGTTCGTTTTCCGTGTGT

GGTTTATATCAATGAAGTCCGAGTTATACCCCCGGGAGTACGAGCCCATAGTGGCTTACCTGACAACAGAGCATATGG GGAAACATCTCCTCACACATT

TCAACTTGACTTATTCTTCAATAATGTAAGCAAACCAAGTGCTCCAGTTTTTGATAGGTTGGGAAG CCTGGAATATGATGAGAATACGTCTATCATCTT

TAGACCAAACTCGAAG - UNI6684 - GTAAATACTGATGGTCTGGTACTAAGAGGCTGGTACAACTGTCTGACCCTGGCAATATATGGATCGGTAGA

TAGAGTGATAAGCCATGACAGAGACTCTCCACCACCTCCACCTCCACCTCCACCTCCTCCCCAGCCACAGCCGACTTTGAAAAGGAATCTAAAGCATG C

TGATGGTGAGAAGGAAGATCAGTTTAATGGAAGTCCTCCAAGACCCCAGCCACGGGGACCAAGAACTCCTCCTGGACCTCCTCCACCTGATGACGATGAG

GACGACCCTATGTCTTTGCCAG TGTCTGGTGACAAAGAAGAGGATGTTCCCCATCGAGAAGATTACTTTGAGCCCATTTCTCCTGATAGGAATTCTGTC

CCGCAGGAAGGTCAGTATTCCGATGAAGGAGAGGTAGAAGAGGAACCGCAAGAAGAGGGAGAAGATGATGAAGATGATGTGGATGTAGAGGAAGAAGAGG

ATGAAGATGAGGATGACTGCCATACAGTAGATAGTATCCCTGATGATGAGGAAGAAGATGAAGAGGAAGAAGGTGAAGAGGATGAAGAAGGTGAAG - U

NI3080 - GGGACGATGGCTACGAGCAGATCTCTAGTGATGAAGATGGAATTGCTGACTTGGAACGTGAAACATTCAAGTATCCAAACTTCGATGTTGA

GTATACTCCAGAAGACCTGGCATCTGTCCCTCCTATGACGTATGACCCGTATGACAGGGAGCTGGCACCACTCTTGTATTTCAGCTGTCCATACAAAACT

ACTTTTGAAATTGAAATCAGTAGAATGAAGGATCAAGGTCCAGATAAAGAGAATTCAGGGGCAGTAGAAGCCTCGGTGAAGTTAACTGAACTGCTAGACC

TGTATCAGGAAGACAGGGGTGCAAAGTGGGTGACGGCTCTAGAAGAAATTCCAAGTCTAATTATAAAAGGATTAAGCTATTTGCAATTGAAAAACACAGA

ACAAGACTCCCTTGGCCAGTTGGTAGACTGGACAATGCAAGCTTTAAATTTACAAGTAGCCTTTCGACAGCCCATAGCCTTAAATGTCCGACAGCTCAAA

GCTGGGACCAAGCTAGTGACCTCATTAGCAGAATGTGGGGCTCCAGGAGTCACAGAATTGCTACAAGCAGGAGTGATCAATGTATTGTTTGATCTCTTAT

TTGCTGATCATGTCTCATCTTCCCTTAAGTTAAATGCTTTTAAAGCTTTGGACAGTGTCATTAGCATGACAGAAGGAATGGAGGCTTTTTTAAGAAGCAC

CCAAAATGAGAAAAGTGGCTATCAAAGACTTCTGGAACTCATACTTCTGGATCAGACTGTGAGGGTTGTCACTGCTGGCTCAGCTATTCTTCAAAAATGC

CATTTCTATGAAATCTTGTCAGAGATTAAAAGACTTGGTGACCACATAGCAGAGAAGACTTCAGCTGTTCCTAACCACAGTGAGCCTGACCAGGACACAG

ATGCTGTGCTGGAGAGAGCAAATCCCGATTATGAGAATGAAGTAGAAGCTTCTATGGACATGGATCTTTTGGAGTCCTCAATTATAAGTGAAGGTGAAAT

AGAAAAGCTTACTAATCTCTTAGAGGAGGTTTTTCATGTCATGGAAACTGCACCTCATACAATGACCCAACCTCCTGTCAAGTCTTTCCCCACAATAGCC

CGGATTACCGGGCCTCCAGAGCGGGATGACCCGTACCCTGTCCTCTTTAG AGGGCCTGGGTTTGGTTTTCAGCACTCAATAGTGGCTCACAGCCATCAG

CTACTCCAGTTCCAGAGGGTCCAGTGCCCTCTTCTGGCCTATGTGGGCACTGTACACACATGGTACATAGACACATGCAAGCAAAATACTCATGACATAA

G GTATCTTCACAGCCATCACTTCCTGGAGTTGGTCACCTTGCTTCTGTCGATTCCAATAACAAGTGCCCATCAGGGTGTACTGCAAGCCACGAAGGATG

TTTTAAAGTTTCTTGCACAGTCACAAAAGGGCCTTCTCTTTTTTATGTCAGAATATGAAGCGACAAACTTGTTGATCCGAGCTCTGTGCCACCTTTATGA

TCAAGACGAAGAGGAAGGCCTTCAGTCTGATGGGGCTGATGATGCCTTTGCCTTGTGGCTGCAGGACTCAACTCAGACTCTGCAGTGCATCACAGAGCTG

TTCAGCCATTTCCAGCGGTGTACAGCCAGTGAAGAAACTGACCATTCTGATCTCCTGGGCACCCTCCACAATCTTTACTTGATTACTTTTAACCCTGTGG

GAAGATCAGCTGTTGGCCATGTTTTCAGCCTTGACAAAAACCTTCAAAGTCTCATTACTCTAATGGAGTACTATTCCAAAGAAGCCCTAGG - UNI182

5 - CGATTCCAAGTCTAAGAAGTCAGTAGCTTATAATTACGCATGCGTACTCACGCTGGTGGTGGCTCAGTCTTCCAGCGGTGTCCAGATGTTAGAACA

GCACGCAGCATCGCTCTTGAAGCTCTGCAAAGCAGATGAAAATAATGCGAAATTGCAAG - UNI6783 - AACTTGGCAAATGGCTTGAACCTCTGAA

AAACCTCAGATTTGAAATTAACTGCATCCCAAATCTAATTGAATATGTTAAACAG - UNI3661 - AATATTGATAACTTGATGACTGCAGAAGGAGT

TGGCCTTACCACTGCCTTACGTGTTCTCTGTAATGTGGCATGTCCACCACCTCCCGTAGAAG - UNI21419 - GTCAGCAGAAAGACCTGAAATGGA

ACCTTGCTGTTATTCAGCTTTTTTCTGCTGAAGGAATGGACACCTTTATTCGGGTTCTGCAAAAACTGAACAGTATTTTGACGCAGCCTTGGAGGCTCCA

TGTGAACATGGGGACTACCCTGCACAGAGTCACTACCATTTCAATGGCTCGCTGCACGCTCACTCTGCTTAAAACTATGCTGACAGAGCTCCTGCGAGGC

GGATCCTTTGAGTTTAAGGACATGCGTGTTCCTTCAGCACTTGTTACTTTACACATGCTCCTGTGCTCTATCCCTCTCTCAGGTCGTTTGGATAGTGATG

AGCAGAAAATTCAGAATGATATCATAGATATCTTACTGACTTTTACACAAGGAGTCAATGAGAAGCTCACGATCTCGGAAGAGACTCTGGCCAATAATAC

TTGGTCTTTAATGTTAAAGGAAGTTCTCTCTTCCATCTTGAAGGTTCCGGAAGGCTTCTTCTCAGGACTCATACTCCTTTCAGAGCTGCTGCCTCTTCCC

TTGCCCATGCAGACCACGCAG - UNI21419 - GTTATTGAGCCACATGATATATCAGTGGCACTCAACACCCGAAAATTGTGGAGCATGCACCTTCA

TGTTCAAGCAAAGTTGCTCCAAGAAATAGTTCGTTCTTTCTCTGGCACAACCTGCCAGCCCATTCAACATATGTTACGGCGTATTTGTGTTCAATTGTGT

GACCTTGCCTCTCCAACTGCTCTTCTGATCATGAGAACTGTGTTGGATTTGATTGTAGAAGACTTGCAAAG - UNI32052 - CACTTCAGAAGATAA

AGAAAAACAGTATACTAGCCAAACCACCAGGTTGCTTGCTCTTCTCGATGCCCTGGCTTCACACAAAGCTTGTAAATTAGCTATTTTGCATCTAATTAAT

GGAACTATTAAAGGCGATGAAAGATATGCAGAGATCTTCCAGGATCTTTTAGCTTTGGTGCGCTCTCCTGGGGACAGTGTTACTCGCCAGCAGTGCGTGG

AGTATGTCACATCCATTTTGCAGTCTCTCTGTGACCAG - UNI18157 - GACATTGCACTCATTTTGCCAAGCCCTTCTGAAGGTCCTGCCTCTGAG

CTTGAACAGCTCTCTAACTCCCTACCAAGTAAAGAGCTGATGACTGCAATCTGCGACTGTCTGCTGGCAACTCTAGCCAACTCTGAAAGCAGTTACAACT

GTCTGCTGACATGTGTCCGTACAATGATGTTTCTTGCAGAGCACGATTATGGATTGTTTCACCTGAAAAG - UNI25105 - CTCTTTAAGGAAGAAC

AGTAGTGCTCTGCATAGTTTGCTGAAGCGAGTGGTCAGCACATTCAGTAAGGACACCGGTGAGCTTGCATCGGCGTCTCTGGACTTCATGAGACAGATCC

TCAATGCTGATGCTATG - UNI4311 - GGCTGTTGTGGAGACGATAGTGGTCTCATGGAGGTAGAGGGCGCTCACCCACCCCGGACGATGAGTCTTA

ACGCTGCAGAGTTAAAACAGCTCCTACAGAGCAAAGAAGAGAGTCCAGAGAGTCTGTTCCTTGAACTAGAGAAGCTTGTTTTG GAACATTCTAAAGATG

ATGACAGTCTGGAGTCTTTGCTGGATAATGTAATTGGACTGAAGCAGATGCTGGAGTCATCTGGTGAGCCTTTGCCTCTCAGTGACCAAGATGTAGAGCC

AGTACTGTCAGCTCCAGAGTCTCTCCAGAATTTATTTAACAACAG GACTGCATATGTGTTGGCTGATGTCATGGATGATCAGTTGAAATCTATGTGGTT

TACTCCATTTCAGGCTGAAGAGATCGATACAGACTTGGATTTG GTAAAGGTTGACTTAATTGAGCTTTCAGAAAAGTGCTGCAGTGATTTTGATTTGCA

TTCAGAACTAGAGCGCTCGTTTCTGTCAGAACCATCATCTCCAGGAAGATCCAAGACTACTAAGGGATTTAAACTCGGGAAGCATAAGCATGAGACATTC

ATAACTTCAAG TGGAAAATCTGAATACATTGAACCTGCCAAACGAGCTCATGTTGTGCCGCCACCTAGAGGCCGGGGCCGGGGAGGATTTGGACAGGGC

ATACGGCCCCATGATATTTTCCGTCAGAGAAAGCAGAACACGAGCAGGCCGCCATCTATGCACGTGGATGACTTTGTTGCAGCTGAAAGTAAAGAAGTGG

TCCCTCAAGATGGAATACCCCCACCAAAACGGCCACTCAAAGTCTCACAAAAGATTTCCTCTCGTGGTGGATTTTCAGGCAACCGAGGAGGACGGGGTGC

TTTTCATAGTCAGAACAGGTTTTTCACACCGCCTGCTTCGAAAG - UNI5873 - GAAACTACAGTCGTCGGGAAGGAACAAGAGGCTCGAGTTGGAG

TGCTCAGAACACTCCTCGAGGAAATTATAATGAAAGCCGAGGGGGCCAGAGCAACTTTAACAGGGGTCCTCTTCCACCATTACGGCCGCTTAGTTCTACG

G - UNI16455 - GTTACCGCCCTAGTCCCCGGGATCGAGCTTCTAGAGGCCGCGGGGGCCTGGGACCGTCCTGGGCTAGTACAAATAGCGGCAGTGG

AGGCTCGAGAGGAAAGTTTGTTAGTGGAGGCAGTGGTAGAGGCCGTCATGTACGGTCCTTTACTCGATAGATGTGTTCTTGGCAACACCCCAAGTAAATG

CACATTTCATGAGGACAAAAACAAACAGACCTTGAAGGACCAATTTAGACTTAACAGTTATATCTGGATACATCTGAGAGAATATTTTTATCTGAAGAAA

GCAGATTTTGTTTGATACTTAATGAGATTTCAATAAAAATCCAAACTTTGTACGTATGTTTGTATATATTTTTCCCATTTTATATGGTATTTATTTAGAA

AGTTTCTAGGTAGAAAGAAAAAAACAATGATTTTTTTTTTTTGTATTTCTCTTGCTTATACTATAGATATTTCCAAACTTTCTTAGCCTGTGACACCCTT

TAGTGTGTCTCGGGAATTTTTTCACAGTATCCCTAGGCCAAAAACAAACTTGATACTTTTGTTTATTGAACAGTTAGGGTCCAAGCAACTGAAGACTTTC

CACCATCATCACCACTAGTAACTGGACACCGCTCAAGGCCTCACTCACCCTTGGAAACAGCAGCCTTCCCTGTCCGGGTTTCCTGAGCAGTACTGTTTAT

CAAACTGCTGAATGGTCGTTACAAATGTGTGCTGTCCTGGAAAGTCACCCAGTGTTACCCAGTGCTGAAAATGGGAACTACCTCAATTCATAGTTTGTGT

GGTGCCCAGCAGATGTCGCTGTTTCCTCAGAAGTTTAAAACACTCATGCTAATTTACTAAGGTGCCCACCACACAATTTAGCAATCATTGCTGTACCAGA

AGGAGCAAAAACTTCTTTATGTTAGAAGTACAGACTTTGCTTCAAGTTCGGACCTACTGATGCTATTTTATTATAGAGTTATTTAAAGCCTAAAAGTTGG

CTTATCTTAATGCGGTTATTTTGGGAATCAGAAGCATCTACTTTATATTCAGAAATAAAACTTATAACTTTGACCAAGGAGCCATATTTCCCCTAAGGTA

TGTCTTAATTCATTGAGCCTATATAAATGGCATAAAATATAGAGTTCTCTTAAACAAAAATAAGTGTATGAGTCTCATTCCATCCTAACAGCCTCTATTT

TGGGGAATCACTTGAGTGCATTTAATATATATTTATTAGGAAAAAAGGCCTCGAAAAGTTCAGCTTTAGAATTGAGGGTTTAGCTTATTGATAGAAGTAG

TTGCCTAGCATGTGTGATTAACTACTAGCAATGTTTCTGAGTGTGTGTGTGTGAGCATGCACATGTGTACACATACATGTGCATGGAAATTTCAGATGGA

AGGATTCTGATGTTTAAGTACAAGGTGATGAAAATCTTCTTACTATTCTGGAACAACCCAAACTCTTAGTCTGCTCAGGCTGCTATAACATCATAAAATA

GACTGGATGGCTTATATAAGAAGAAAATCTCACAGTTCCATTGGTCAGGCAGTCGGTAAAAGCAGGCTCTGGGGAGGCACTCCTTGTAGACTTTTCACAT

GGGCTTTCTGTAGT
Translation
MAVDSSMELLFLDTFKHPSAE - UNI23032 - QSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYG GETSPHTFQLDLFFNNVSKPSAPVF

DRLGS SLEYDENTSIIFRPNSK - UNI6684 - VNTDGLVLRGWYNCLTLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPTLKRNLKHA ADGEKE

DQFNGSPPRPQPRGPRTPPGPPPPDDDEDDPMSLPV VSGDKEEDVPHREDYFEPISPDRNSVPQEGQYSDEGEVEEEPQEEGEDDEDDVDVEEEEDEDE

DDCHTVDSIPDDEEEDEEEEGEEDEEGEG - UNI3080 - GDDGYEQISSDEDGIADLERETFKYPNFDVEYTPEDLASVPPMTYDPYDRELAPLLYF

SCPYKTTFEIEISRMKDQGPDKENSGAVEASVKLTELLDLYQEDRGAKWVTALEEIPSLIIKGLSYLQLKNTEQDSLGQLVDWTMQALNLQVAFRQPIAL

NVRQLKAGTKLVTSLAECGAPGVTELLQAGVINVLFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFLRSTQNEKSGYQRLLELILLDQTVRVVTAGS

AILQKCHFYEILSEIKRLGDHIAEKTSAVPNHSEPDQDTDAVLERANPDYENEVEASMDMDLLESSIISEGEIEKLTNLLEEVFHVMETAPHTMTQPPVK

SFPTIARITGPPERDDPYPVLFR RGPGFGFQHSIVAHSHQLLQFQRVQCPLLAYVGTVHTWYIDTCKQNTHDIR RYLHSHHFLELVTLLLSIPITSAH

QGVLQATKDVLKFLAQSQKGLLFFMSEYEATNLLIRALCHLYDQDEEEGLQSDGADDAFALWLQDSTQTLQCITELFSHFQRCTASEETDHSDLLGTLHN

LYLITFNPVGRSAVGHVFSLDKNLQSLITLMEYYSKEALG - UNI1825 - GDSKSKKSVAYNYACVLTLVVAQSSSGVQMLEQHAASLLKLCKADEN

NAKLQE - UNI6783 - ELGKWLEPLKNLRFEINCIPNLIEYVKQ - UNI3661 - NIDNLMTAEGVGLTTALRVLCNVACPPPPVEG - UNI21

419 - GQQKDLKWNLAVIQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMGTTLHRVTTISMARCTLTLLKTMLTELLRGGSFEFKDMRVPSALVTLHM

LLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQ - UNI21419 

- VIEPHDISVALNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQPIQHMLRRICVQLCDLASPTALLIMRTVLDLIVEDLQS - UNI32052 - STSED

KEKQYTSQTTRLLALLDALASHKACKLAILHLINGTIKGDERYAEIFQDLLALVRSPGDSVTRQQCVEYVTSILQSLCDQ - UNI18157 - DIALIL

PSPSEGPASELEQLSNSLPSKELMTAICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKS - UNI25105 - SSLRKNSSALHSLLKRVVS

TFSKDTGELASASLDFMRQILNADAM - UNI4311 - GCCGDDSGLMEVEGAHPPRTMSLNAAELKQLLQSKEESPESLFLELEKLVL EHSKDDDSL

ESLLDNVIGLKQMLESSGEPLPLSDQDVEPVLSAPESLQNLFNNR RTAYVLADVMDDQLKSMWFTPFQAEEIDTDLDL VKVDLIELSEKCCSDFDLHS

ELERSFLSEPSSPGRSKTTKGFKLGKHKHETFITSS SGKSEYIEPAKRAHVVPPPRGRGRGGFGQGIRPHDIFRQRKQNTSRPPSMHVDDFVAAESKEV

VPQDGIPPPKRPLKVSQKISSRGGFSGNRGGRGAFHSQNRFFTPPASKG - UNI5873 - GNYSRREGTRGSSWSAQNTPRGNYNESRGGQSNFNRGP

LPPLRPLSSTG - UNI16455 - GYRPSPRDRASRGRGGLGPSWASTNSGSGGSRGKFVSGGSGRGRHVRSFTR

For any suggestions or comments, please send an email to unitrap@crg.es