Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040721 (Zfhx2)
Chromosomal location
Chr 14: 55680498 - 55710885 (-)
Description
zinc finger homeobox 2 Gene [Source:MGI Symbol;Acc:MGI:2686934]
RefSeq_dna
NM_001039198 
RefSeq_peptide
NP_001034287.1 
UniGene
Mm.441113 
MGI
MGI:2686934 
Uniprot/SPTREMBL
Q2MHN3 Q5DU04 Q80VJ9 
Human Ortholog
ENSG00000136367 (ZFHX2)
Omim not available
UniTrap UNI12168
Vector Insertion
Chr 14: 55694122 - 55710844
Public Clones (sanger) E119A12 (ggtc) D136E11 (ggtc) P145D02 (ggtc) D174F01 (ggtc)
D053D10 (ggtc) P093B11 (ggtc) D171A09 (ggtc) D026F05 (ggtc) W207D04 (ggtc)
E119A11 (ggtc) Q010D08 (ggtc) D147E12 (ggtc) D021E10 (ggtc) D179H11 (ggtc)
D070G09 (ggtc) 3SE142G01 (ggtc) P093B12 (ggtc) D029C12 (ggtc) PST18468-NR (escells)
PST1707-1 (escells) IST12692F2 (tigm) IST12474F10 (tigm) IST14159C3 (tigm)
IST10456H1 (tigm) IST10688D12 (tigm) IST14163C9 (tigm) IST11931F1 (tigm)
IST14515E5 (tigm) IST10164D9 (tigm) IST14164H3 (tigm) IST12009D9 (tigm)
IST14457D2 (tigm) IST10092B9 (tigm) IST13200E12 (tigm) IST10909C10 (tigm)
IST10895C10 (tigm) IST10246G10 (tigm) IST10130H9 (tigm) IST11205C11 (tigm)
IST12755F2 (tigm) IST12546E8 (tigm) IST14676C8 (tigm) IST11689C2 (tigm)
IST14578H11 (tigm) IST14734G1 (tigm) IST14132C2 (tigm) IST14790H7 (tigm)
IST11585E1 (tigm) IST12951F12 (tigm) IST10348E7 (tigm) IST13549E10 (tigm)
IST14192D6 (tigm)
Private Clones OST456647 (lexicon) OST422742 (lexicon) OST368354 (lexicon) OST316454 (lexicon)
OST314478 (lexicon) OST284064 (lexicon) OST252915 (lexicon) OST242525 (lexicon)
OST241131 (lexicon) OST193743 (lexicon) OST191409 (lexicon) OST176004 (lexicon)
OST161025 (lexicon) OST148007 (lexicon) OST135898 (lexicon) OST132046 (lexicon)
OST127467 (lexicon) OST114589 (lexicon) OST90103 (lexicon) OST82810 (lexicon)
OST77760 (lexicon) OST31057 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15465
Vector Insertion
Chr 14: 55689397 - 55690937
Public Clones PST8114-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37453
Vector Insertion
Chr 14: 55686944 - 55689035
Public Clones PST21492-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6459
Vector Insertion
Chr 14: 55686119 - 55686321
Public Clones CSA151 (baygenomics) PST5418-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22680
Vector Insertion
Chr 14: 55682409 - 55682641
Public Clones not available
Private Clones OST288029 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036328
Sequence
GCGGCCGCGGTTCGACTCCCGTCCCTGCTTCCAGCTGAGGT - UNI12168 - GGTACTGGCTGTCACGCTGAAATGAACCCTCAGCAGTCCTCCGTC

TACCATGGCTACCCTTAACTCAGCCTCTCCCTCCGGAACCGTTCCTTCCCCTGGGCACAATGTTCGGTCACCACCTCCAGAGACCTCCTCCTCCAGCACC

TCTGATCCTGTCACCAAAGATCCCCCTGATGCCCCCTCCACCTCTGAGAGCATAAGGTCCTCAGAGCCGGGGGGAGAGCGTCTGGAGTCAGGCAGTGACC

TTGACCCACCAAAGGAGATTGGAGAGCCCCAAGAAGAGCCTGGCTGTGGCCACATCCCACCAAAGGACCTTGGGGTGGCAAAGGAGGAGGAAGAGATCCT

TCCTTTGGACCTCAGCAGCCACTTATTCTTCGCAGCTGGAGGCCAGGCCTACCTACTGGCCAACCTGCCCCTGCCTAGGGGCAGTGAACTCTCGTTACCA

AAGGGCTTCCCCTGGGATGAGGCAAGCGCCAAGGAAGAGCCCAGCCTGCCCCTCCTCACCCACTTCCCCTCCTCACACCTTACCACCCTTCACATCCAAC

ATGGCTTCGACCCAATCCAAGGCTTTAGCTCTTCTGACCAAATGTTGTCCCACGATACCTCAGCGCCGTCTCTGGCTGCCTGTGAGAGAAGGGATGGATC

CTTCTGGAGCTACCAGCTGGTTCCAAACCCAACCGAAGATCCCAAAGATGGCCCCCTGGGGAGCCGACGGGAAGACCACAGGGCGATGTTTTGGATCTGC

CTTCTCTGCCGCCTGGGTTTCGGCAGGCTCCAGACCTTCATAGGTCACACACTTTCTCATGGAGTGAAGCTGAGCCCTGCCCACCACCAGGGCCTGCTGG

GCAGCCCAGCCGTACTTCAGGAGGGTCATGATGGCGGCATGGCCCTCCTAAGCTTTCTGGAACCAAAATTTCTTACCCGTCCTTCTCCCGAAGTACCGGA

CACCAGCACAGTGACTGTGAAGACAAATGGAGCCCAGGCTGAGGACGGCCCCCCAGAGGCAGATGGTCAAGCCCTTGTTCTCCCCGCTGAAGAGGTTATA

GCCCTCAGCCCACCATCCCCACCCACAGCCCTAGCCACCTGGGACCCCAGCCCAACCCAAGCCAAAGATTCGCCAGTACCAAGAGGCGAGGCGGGGCCAG

ACTGGTTCCCTGAGGGGCAGGAAGAGGATGGAGGGCTCTGCCTCCCGCTCAACCAAAGCTCACCCACCTCTAAGGAGGTGGCCGTGCTCCCAGCTCCAGC

AGGCTCTCCCGAAGATACCAGTGACCCACCTCCGTCCTGTCGCCTGGCCGATGACTACACTCCAGCCCCTGCCGCCTTCCAGGGCCTCAGCCTGTCCAGT

CACATGTCCCTGCTACACTCACGCAATTCCTGCAAGACTCTCAAGTGTCCCAAGTGCAACTGGCACTACAAGTACCAGCAGACCCTGGACGTGCACATGC

GGGAGAAGCACCCCGAGAGCAACAGCCACTGCAGCTACTGTAGCGCCGGGGGCGCCCACCCCCGCCTGGCCCGCGGAGAGAGCTACAACTGCGGCTACAA

GCCCTACCGCTGCGATGTCTGCAACTACTCCACCACCACCAAAGGCAACCTCAGCATCCACATGCAGTCCGACAAGCACCTGGCCAACCTGCAGGGCTTC

CAGGCAGGGCCTGGCGGGCAGGCGAGTCCCCCGGAGGCATCCCTCCCACCCACCTCTGTCGGGGATAAAGAGCCCAAGACCAAGTCATCCTGGCAGTGCA

AAGTGTGCAGCTACGAAACCAACATCTCCCGAAACCTGCGCATCCACATGACTTCTGAGAAACACATGCAGAACGTCCTGATGTTGCACCAGGGGCTGCC

ACTTGGCCTGCCACCAGGGCTGGTGGGGCCAGGACCTCCTCCCCCACCAGGGGCTGCCCCCACCAACCCTCCTGAACTCTTCCAGTACTTTGGGCCCCAG

GCCCTAGGACAGCCTCAGACACCCATGCCTGGGCCCGGGCTGAGGCCAGACAAGCCCCTTGAAGCCCAGCTACTCCTAAATGGTTTCCACCACCTTGGAG

CGCCTGCCCGCAAGTTCCCCACAGCTG CCCCTGGCAGCCTCTCCCCTGAGACCCATCTGCCACCAAGTCAGCTCCTGGGCTCCTCATCTGATGGGCTGC

CCACTTCGCCATCCCCAGATGACAGCCCAGCCCTGAAGGTGTTCCGCTGCCTGGTGTGCCAGGCTTTCAGCACAGACAGCCTGGAGCTGCTGCTGTACCA

CTGCAGCATTGGCCGGAGCCTGCCGGAGGCCGAATGGAAGGAGGTAGCTGGGGATACCCACCGCTGCAAGCTCTGCTGCTATGGCACCCAGCTCAAGGCC

AACTTCCAGCTCCACCTCAAGACCGACAAACACACTCAGAAATACCAGCTAGCAGCCCACCTCCGGGAGGGGGGCGGAGCCATGGGCACCCCTTCCCTAC

TGGCCCTGGGGGATGGGGCTTCTTACGGCTCCATCTCCCCACTTCACCTGCGCTGCAACATCTGTGACTTCGAGTCCAACAGCAAGGAGAAGATGCAGCT

GCACACCCGGGGTTCAGCCCACGAAGAAAACAGCCAGATCTATAAG - UNI15465 - TTTCTGCTGGAAATGGAGGGAGCAGAGGCAGGGCCGGAGC

CCGGGCTTTACCACTGCCTGTTGTGCGCCTGGGACACGCCCTCCCGCCTAGCCTTGCTGCAACACCTACGCACGCCTGCCCACCGGGACGCCCAGGCCCA

GAGGCGGCTGCAGCTGCTGCAGAACGGCCCAGCCGCTGAAGAAGGACTCTCAGCTCTCCAGAGTATTCTGAGCTTCAGCCATGGGCGGCTTCAAACTCCT

G - UNI15465 - GGAAGGCTTCTGACACCCCCTTAGCTCAACCACCCACCTCTGAGAAAGATGCCCAGAACAAGACGGAACAACAGG - UNI1546

5 - CTTCCGAAGTGACAGAGGACAGAAGCGGCCCTCCCAGAGATAGTGCCAACCAGATCACG GTCTTCTGCTGTCCCTACTGTAGCTTCCTGAGCCCA

GAGTGTGACCAGGTGAGGGTCCATACACTCTCCCAGCATGCCGTGCAGCCCAAGTACAGGTGCCCACTCTGCCAGGAGCAGCTGGTGGGCCGGCCTGCCT

TGCACTTCCACCTCAGCCACCTTCACAATGTGGTGCCCGAGTGCGTCGAGAAGCTGCTGCTTGTG GCCACAACTGTAGAGATGACCTTCGCAACCAAAA

TGCTTCCTGGACCCACATTAAACCCTGTGGAGGATGGCCTAGACCACCCAGCTCCTGGAGCAGAGCCCACTCCCAACAGAGACCAAGTAGCAG - UNI6

459 - AAAGCTCTAACCTGGCCCCAGAAGTCAGCCCAGATCCTCCTCTTGAGCCTCCCCTGGCGCCAGTCGAGGGCTCCAGGGAGCCCTCAGAAAGCCC

TGATCAGCCGCCTTCTCCAGCCCCATCTCCAGCCCCTCGGCTTGATGCCCAGGTTGAAGAATTGGCTCCTCTACCCACCATGTCTGAAGAGGAAGAGGGA

GCTATGGGGGAGCCCCGCTCTGCAGAACCAACCCCAGCTGACTCCCGCCACCCTCTAACCTATCGGAAGACCACAAACTTTGCCCTGGACAAGTTTCTTG

ACCCTGCTCGGCCCTATAAGTGCACTGTGTGTAAGGAGTCCTTCACCCAGAAGAACATCCTGTTGGTTCATTACAACTCCGTCTCTCACCTTCATAAGAT

GAAGAAGGCAGCCATTGACCCATCGGGCCCTGCCCGAGGCGAGGCGGGCATCCCACCGCCCGCCGCCACTGCGTCAGACAAGCCCTTTAAGTGCACAGTC

TGCCGAGTGTCCTATAACCAGAGCTCCACACTGGAGATTCACATGCGATCAGTTCTGCACCAGACACGCTCGAGGGGGGCCAAGATCGACGCCAGGGCTG

AAGGAGCAGAGCGGGGCCAAGAAGAGTTCAAGGAAGGCGAGACTGAGGGCGAGGCAGGTACTGAGAAGAAAGGCCCTGACCCTGGTGGCTTCATGTCTGG

ACTGCCTTTCTTGTCCCCACCACCTCCTCCCTTGGATCTACACCGATTCTCAGCCCCTCTCTTCACCCCACCAGTCCTGCCCCCGTTCCCCCTGGTTCCA

GAATCACTACTCAAGCTCCAGCAACAACAGCTGCTTCTTCCCTTCTACCTCCATGACCTCAAGGTGGGGCCCAAGCTGGCACTGGCTAGCCCTACGCCCA

TGCTGTCCCTGCCCGCTGCCAACCCACCTCCTCTCCCTGCACCCCCCAAGGCTGAGCTGGCTGAGCAGGAATGGGAACGGCCCCTCATGGCTGAAGAGGG

GACTGAAGCGGGGCCTTCTTCACCAACCCACACATCACCCAATGAAGCTGCCCGCACAGCAGCCAAAGCCCTTCTAGAAAATTTTGGCTTTGAGTTAGTG

ATTCAGTACAACGAAGGGAAGCAGGCAGTGCCCCCTCCCCCAACTCCTCCGCCTCCAGAGTCTCTGGGGGGCGGAGACAAGCTGGCCTGTGGGGCCTGTG

GGAAACTCTTCTCCAACATGCTCATCCTCAAGACTCATGAGGAACATGTCCACCGCCGCTTTCTGCCCTTTGAGGCTCTGAGCCGTTACGCCGCTCAGTT

TCGAAAGAGCTATGATAGCCTATACCCACCCCCAGTAGAGCCCCCCAAACCTCCAGACGGGTGCCTGGAGTCACCTCCCCAGCTAGGCCCACCTTTCGTG

GTCCCAGAACCTGAAGTAGGGGGGATCCACACTTCTGAAGAGCGGAGCCTGTCAGGAGGAGGACCCTGGCCCTCTGAGGAAGAAGAAGGCTCTAGAGGGA

GTCTTCCTCCCGCAGTACCTGTGGGCCGCCGGTTCTCTAGAACCAAGTTTACAGAGTTCCAGACCCAGGCTCTACAGTCTTTCTTTGAGACCAGTGCCTA

CCCCAAGGACGGGGAGGTGGAGCGCCTGGCAAGCCTCTTGGGTCTGGCTAGCCGCGTGGTGGTAGTGTGGTTCCAGAATGCCCGCCAGAAAGCCCGTAAA

AATGCCTGTGAGGGTGGGCCTGTGACAGCCGGAGGAGCCTCTGGAGGGGCCTCTGGCTGCAGGCGCTGCCACGCCACCTTCGCCTGTGTTTTTGAGTTAG

TTAGGCACCTCAAGAAGTGCTATGATGACCAGCCTCCTGAGGAGGAGGAGGAGGCAGAGAGGGGGGAAGAGGAGGAAGAGGTGGAGGAAGAGGAGGCGGA

GGAACGGAACCTGGAACCCGCAGCAGCAAGACCTGGCGGCCCATCACCAGAACATGCAGATGGGGAAGACTTGAGCCAAACGGAGCCAACAAGGCCAGAA

AGCAAAGAGTCTGAAGGGAAGGCACCGCCCTCACCTCCCGTCTATGCCTGTGACCAGTGTGCCGCTTCTTTCCCCAGCCAGGACCTCCTGACCACTCACC

ATCGACTCCATTTGCTACCATCTGTGCAGCCCAGCGCCCCGCCACCGTCCCAGCTCCTAGATCTACCCTTGCTGGTGTTTGGGGAGCGGAACCCAGTAGT

ATCGGGCACCTCATCAGTGACCGGGACACCCCTCAAGCGGAAGCACGATGACGGCAGTCTGTCTCCCACAGGCAGTGAAGCAGGAGGCGGAGGAGAGGGT

GAACCCCCCAAAGACAAACGCCTGCGCACTACCATCCTGCCTGAGCAGCTGGAGATCCTGTACCGCTGGTACATGCAGGACTCCAACCCCACACGGAAGA

TGCTCGACTGTATCTCTGAGGAAGTGGGACTCAAAAAACGAGTAGTACAGGTCTGGTTCCAGAATACCAGAGCCCGGGAGAGGAAAGGTCAGTTTCGAAG

CACCCCTGGGGGAGTTGCCGGTCCAGCAGTCAAGCCCACTGTACCGCCCTCCCCAGCTCCCTTCCCCAAATTCAACCTCCTGTTGAGCAAGATTGAAGAC

GAAACGGGGAAGGAAGCCCCAAAGAGAGACGCACCTGCCTTTCCCTACCCCACAGTCACCCCTGCTGTTGGGCCTCTGCCATTCCTACCACCTGGGAAAG

AGGCCGCTGTACCAACACCAGAGCCCCCACCACCCCTCCCGCCCCCAGCACTCAGTGAGGACGAGGGTCCAGAGGAACCATCTAAAGCGTCTCCAGAAAG

CGAGGCTTGCAGTCCATCGGCAGGAGACCTAAGTGATTCATCTGCTTCCAGCCTGGCTGAACCAGAATCCCCTGGGGCCGGGGGGACCAGTGGGGGACCA

GGCGGTGGGACCGGAGTTCCAGATAGCATGGGGCAGCGGCGATATCGGACCCAAATGAGCAGCCTTCAGCTGAAGATCATGAAAGCCTGCTATGAAGCCT

ACCGCACCCCTACTATGCAGGAGTGTGAAGTCCTCGGGGAGGAAATTGGACTGCCCAAGAGAGTCATTCAGGTCTGGTTCCAGAATGCCCGTGCCAAGGA

AAAAAAAGCCAAACTGCAGGGAACAGCACCACCAGGGAGCGGGGGCAGCAGTGAGGGCACCTCGGCAGCCCAGCGCACCGACTGTCCCTACTGTGACGTT

AAGTATGACTTCTACGTCTCCTGCAGAGGCCACCTCTTCTCTCGGCAGCACCTTGCCAAGCTCAAGGAGGCAGTCCGAGCCCAGCTGAAGAGCGAAAGCA

AATGCTATGACTTAGCTCCCGCACCCGAGACCCCACTGGCCCCCAAAGGGCCACCTGCCACCACACCTGCCTCCTCCGTGCCCTTGGGGGCTTCCCCAAC

CTTGCCTCGCCTGGCTCCAGTCCTCTTGCCTGGCCCAACTCTGGCCCAGCCACCACTTGGAAGCATAGCTTCTTTCAATTCAG - UNI22680 - GCC

CTGCAGCCTCCTCAGGCCTTCTTGGCCTTGCCACTTCGGTCCTGCCTGCTACCACAGTGGTCCAGACTGCTGGTCCAGGCCGCCCCTTACCTCAGAGACC

TGTATCTAACCAAACCAACAGTTCTACTGACCCTACCCCTGGCCCAGCTACTGAGCCCTCAGGAGACAAAGTCTCTGGTGAGCGAAAGCCAGTTGCAACC

CTTCCCAACTCTTCCACTGATGCCCTCAAGAACCTGAAAGCATTGAAAGCCACTGTCCCAGCCCTGTTGGGGGGCCAATTCCTGCCCTTCCCATTGCCCC

CTGCAGGCGGGGCAGCACCACCAGCTGTCTTTGGTCCTCAGTTACAGGGGGCATACTTCCAACAGCTTTACGGCATGAAGAAGGGGCTATTTCCCATGAA

CCCGGTGATACCTCAGACCCTTATTGGGCTGCTCCCCAATGCCCTCCTCCAGCAACCACCCCAAGCCCCCGAGCCTACAGCCACAGCCCCTCCAAAGCCC

CCCGAGCTGCCGGCTTCGGGGGAAGGGGAAAGTAGTGAGGCTGATGAGCTGCTGACAGGCAGCACTGGCATCTCCACCGTGGATGTGACTCACCGCTACT

TGTGCCGCCAGTGCAAGATGGCATTTGACGGCGAGGCCCCAGCTACTGCCCACCAGAGATCCTTCTGCTTCTTTGGGCGGGGCTCTGGGGCCTCCATGCC

CGCCCCATTGCGGGTGCCTATCTGCACCTACCACTGCCTGGCCTGCGAGGTGCTGCTGAGTGGGCGTGAAGCCCTAGCCTCCCATCTGCGCTCCTCAGCC

CACAGGCGCAAGGCAGCCCCGCCCCCAGGAGGCCCTCCCATCACCGTTACCAACAGCGCCACTGCTGTCCCGGCTGCTGTGGCTTTTGCCAAAGAGGAAG

CAAGATTACCTCACACGGACCCCAACCCAAAAACTACTACTACCTCTACACTTCTAGCTTTATAAACAGATAAACCAAGATGGGGACAAGAGAGGGCCTC

AGGGTTCCCTCACCCCAACCTTCAGCTCTGCCCACCTCATGGGAGTCTGTCAATTCCCACCTTCCGTGGGCTTCACACACCCCACCTCCAGCAGAGTCCT

GCCTCCTCCCCGCCCCACAAACACACTGACCCTCATTCTCAGCCCCTTGCAGATGCACCCCCACTCTGGCATACATGTCTGCTTTGTTCCCCCATTTCCC

CCATTGAATTCCCAGCCCTCTTCCTTCCCTTGTAAACACATACCTTTTCCATACTACTATATTGACTGAGAAAACACCAAAAGAAAGAAAAAAAGAAAAG

AAAACCCAAGGCAAAAAAGTGGGGGTGGAAAATCAACTTTGCCACCCCCTTCTTCCTGTCCCTTGTCCAGAGCACAGACCGCTCACAAACTCCAAAAACC

CAGTTGGTTCCTATGGTTGGAGCCTGGGGTGGGCAAGGAGCCCATAAAACTAACCAAACGGGAGGCTGGGGGGCGGGGGGAGAAGCACCCCTGCTCCCCT

CCCTCCTGCCCTCTCCTCACCTGGTGGGACCCCTAGCAGCCTGGACTCCTGGGGAAGCGGCTGCCAGAAAGCCCTCTACCAACCCACACCCCTCCCCTGG

AAACTGCAGTAACTTTTTTTTCTCAAAGGCTTTAAACACAGAGGCCCTCTCAGCAGCCATGGGCCTGCCCCTCGCCCTAGCCTTGCTAAGGGCAGTCCAG

CCTCCGGGGATCAGCGTTGCCCACCAATGGCAAATCCAAAGTTCTTTAAAAAAAAAAAAAAAGAAAGAAACACACCAAAATAAACAAGAGCAAGAGAGAG

TGTGCACAGACACAAAAAGAGAGATGGAGAGACCAGAGGAATGAAGTAAAGAAAAACATAAACTTTGAATATACATAGAGAGAGAGAAAAAAAAAGAAAA

CTCTCATC
Translation
 - UNI12168 - MATLNSASPSGTVPSPGHNVRSPPPETSSSSTSDPVTKDPPDAPSTSESIRSSEPGGERLESGSDLDPPKEIGEPQEEPGCGHIPP

KDLGVAKEEEEILPLDLSSHLFFAAGGQAYLLANLPLPRGSELSLPKGFPWDEASAKEEPSLPLLTHFPSSHLTTLHIQHGFDPIQGFSSSDQMLSHDTS

APSLAACERRDGSFWSYQLVPNPTEDPKDGPLGSRREDHRAMFWICLLCRLGFGRLQTFIGHTLSHGVKLSPAHHQGLLGSPAVLQEGHDGGMALLSFLE

PKFLTRPSPEVPDTSTVTVKTNGAQAEDGPPEADGQALVLPAEEVIALSPPSPPTALATWDPSPTQAKDSPVPRGEAGPDWFPEGQEEDGGLCLPLNQSS

PTSKEVAVLPAPAGSPEDTSDPPPSCRLADDYTPAPAAFQGLSLSSHMSLLHSRNSCKTLKCPKCNWHYKYQQTLDVHMREKHPESNSHCSYCSAGGAHP

RLARGESYNCGYKPYRCDVCNYSTTTKGNLSIHMQSDKHLANLQGFQAGPGGQASPPEASLPPTSVGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEK

HMQNVLMLHQGLPLGLPPGLVGPGPPPPPGAAPTNPPELFQYFGPQALGQPQTPMPGPGLRPDKPLEAQLLLNGFHHLGAPARKFPTAA APGSLSPETH

LPPSQLLGSSSDGLPTSPSPDDSPALKVFRCLVCQAFSTDSLELLLYHCSIGRSLPEAEWKEVAGDTHRCKLCCYGTQLKANFQLHLKTDKHTQKYQLAA

HLREGGGAMGTPSLLALGDGASYGSISPLHLRCNICDFESNSKEKMQLHTRGSAHEENSQIYK - UNI15465 - FLLEMEGAEAGPEPGLYHCLLCA

WDTPSRLALLQHLRTPAHRDAQAQRRLQLLQNGPAAEEGLSALQSILSFSHGRLQTPG - UNI15465 - GKASDTPLAQPPTSEKDAQNKTEQQA -

 UNI15465 - ASEVTEDRSGPPRDSANQIT VFCCPYCSFLSPECDQVRVHTLSQHAVQPKYRCPLCQEQLVGRPALHFHLSHLHNVVPECVEKLLLV

 ATTVEMTFATKMLPGPTLNPVEDGLDHPAPGAEPTPNRDQVAE - UNI6459 - ESSNLAPEVSPDPPLEPPLAPVEGSREPSESPDQPPSPAPSPA

PRLDAQVEELAPLPTMSEEEEGAMGEPRSAEPTPADSRHPLTYRKTTNFALDKFLDPARPYKCTVCKESFTQKNILLVHYNSVSHLHKMKKAAIDPSGPA

RGEAGIPPPAATASDKPFKCTVCRVSYNQSSTLEIHMRSVLHQTRSRGAKIDARAEGAERGQEEFKEGETEGEAGTEKKGPDPGGFMSGLPFLSPPPPPL

DLHRFSAPLFTPPVLPPFPLVPESLLKLQQQQLLLPFYLHDLKVGPKLALASPTPMLSLPAANPPPLPAPPKAELAEQEWERPLMAEEGTEAGPSSPTHT

SPNEAARTAAKALLENFGFELVIQYNEGKQAVPPPPTPPPPESLGGGDKLACGACGKLFSNMLILKTHEEHVHRRFLPFEALSRYAAQFRKSYDSLYPPP

VEPPKPPDGCLESPPQLGPPFVVPEPEVGGIHTSEERSLSGGGPWPSEEEEGSRGSLPPAVPVGRRFSRTKFTEFQTQALQSFFETSAYPKDGEVERLAS

LLGLASRVVVVWFQNARQKARKNACEGGPVTAGGASGGASGCRRCHATFACVFELVRHLKKCYDDQPPEEEEEAERGEEEEEVEEEEAEERNLEPAAARP

GGPSPEHADGEDLSQTEPTRPESKESEGKAPPSPPVYACDQCAASFPSQDLLTTHHRLHLLPSVQPSAPPPSQLLDLPLLVFGERNPVVSGTSSVTGTPL

KRKHDDGSLSPTGSEAGGGGEGEPPKDKRLRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVWFQNTRARERKGQFRSTPGGVAGPAVK

PTVPPSPAPFPKFNLLLSKIEDETGKEAPKRDAPAFPYPTVTPAVGPLPFLPPGKEAAVPTPEPPPPLPPPALSEDEGPEEPSKASPESEACSPSAGDLS

DSSASSLAEPESPGAGGTSGGPGGGTGVPDSMGQRRYRTQMSSLQLKIMKACYEAYRTPTMQECEVLGEEIGLPKRVIQVWFQNARAKEKKAKLQGTAPP

GSGGSSEGTSAAQRTDCPYCDVKYDFYVSCRGHLFSRQHLAKLKEAVRAQLKSESKCYDLAPAPETPLAPKGPPATTPASSVPLGASPTLPRLAPVLLPG

PTLAQPPLGSIASFNSG - UNI22680 - GPAASSGLLGLATSVLPATTVVQTAGPGRPLPQRPVSNQTNSSTDPTPGPATEPSGDKVSGERKPVATL

PNSSTDALKNLKALKATVPALLGGQFLPFPLPPAGGAAPPAVFGPQLQGAYFQQLYGMKKGLFPMNPVIPQTLIGLLPNALLQQPPQAPEPTATAPPKPP

ELPASGEGESSEADELLTGSTGISTVDVTHRYLCRQCKMAFDGEAPATAHQRSFCFFGRGSGASMPAPLRVPICTYHCLACEVLLSGREALASHLRSSAH

RRKAAPPPGGPPITVTNSATAVPAAVAFAKEEARLPHTDPNPKTTTTSTLLAL

For any suggestions or comments, please send an email to unitrap@crg.es