Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040722 (Scamp5)
Chromosomal location
Chr 9: 57289135 - 57315831 (-)
Description
secretory carrier membrane protein 5 Gene [Source:MGI Symbol;Acc:MGI:1928948]
RefSeq_dna
NM_020270 
RefSeq_peptide
NP_064666.1 
UniGene
Mm.102278 Mm.401438 Mm.407202 
MGI
MGI:1928948 
Uniprot/SWISSPROT
Q9JKD3 
Human Ortholog
ENSG00000198794 (SCAMP5)
Omim not available
UniTrap UNI16024
Vector Insertion
Chr 9: 57299842 - 57315739
Public Clones (sanger) IST11548D2 (tigm) IST14239A9 (tigm) IST14294D11 (tigm) IST14521A7 (tigm)
IST14157E3 (tigm) IST15000B12 (tigm)
Private Clones OST467737 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7692
Vector Insertion
Chr 9: 57299292 - 57299786
Public Clones RRS150 (baygenomics)
Private Clones OST450079 (lexicon) OST375349 (lexicon) OST364727 (lexicon) OST295993 (lexicon)
OST292037 (lexicon) OST284556 (lexicon) OST278564 (lexicon) OST223945 (lexicon)
OST181463 (lexicon) OST128088 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046587
Sequence
CTCGCGGCCCGCTCCGCGCCTGATCGCCCGGTGCAGCGCAGCTCAGCGCGGCGCAGCGCGACTACCTTTCTGCAGCCGAGCGGTCGGGGCTG - UNI16

024 - GTCAGGACAAAGAGGTGTGAGCAGGCTTACTGAGCTGGCTGATCCATCATGGCGG - UNI7692 - AGAAAGTGAACAACTTCCCACCATTG

CCCAAATTCATCCCACTGAAGCCATGTTTCTACCAAGACTTCGAGGCAGACATCCCTCCTCAGCATCTCAGCTTGACCAAGCGCCTCTACTACCTCTGGA

TGT TGAACAGCGTCACGCTGGCCGTGAACCTGGTGGGCTGTCTCGCGTGGCTGATCGGAGGCGGGGGAGCCACCAACTTTGGCCTGGCCTTTCTCTGGC

TCATCCTCTTCACACCTTGCTCCTACGTCTGCTGGTTTCGGCCCATTTACAAGGCCTTCAA GACAGACAGTTCCTTCAGCTTCATGGCATTCTTCTTCA

CCTTCATGGCTCAGCTGGTCATCAGCATCATCCAGGCTGTGGGAATTCCAGGCTGGGGTGTCTG CGGCTGGATTGCCACCATTTCCTTCTTCGGGACGA

ACATCGGCTCAGCAGTGGTGATGCTCATTCCCACGGTCATGTTCACAGTTGTGGCCGTCTTTTCCTTCATTGCTCTTAGCATG GTTCATAAGTTCTACC

GGGGTAGCGGAGGCAGTTTCAGCAAGGCTCAGGAGGAATGGACCACTGGAGCGTGGAAGAACCCACATGTGCAGCAGGCAGCCCAGAATGCAGCCATGGG

GGCTGCTCAGGGTGCCATGAATCAACCGCAGACTCAGTATTCTGCCACTCCCAACTACACGTACTCCAATGAGATGTGAGCCAGCCAAGCCCACCAGGAG

GCAGGGCTGGGGGCCAGTGGGACAGGGGGCTTAAGCCACATCTTCTGTGTGGTGACCAAGCAGGGTTCCCCCTTCCCTTTTCTCCTCCCCAACTTTGTAC

AAAGAATCAGAGTTATATATATATATATATATATGTGTGTACGTATATGTATATGTCTATCCCTGCCCCCACCTTTGGGTCCTCTGGGAACTTTGCACTG

CACAAGAAGTGTTTTCTGTGCATTGGTAGCCAAGCCTATGTCCCCTTGTGAGATAATGTACAGTGGCGATCTCTTGTTGTGGTGCTAGATGTATGTTTAG

AACTAAACCAGCCCCCTCCATCCATCAGGTTGTCCCCTCTGACCCTGGCCCAGAGACTCCACAGGCCAGGGGGAGGCCTAGCAGGGAGCCAGATACCTTG

TGCAGGGTGATGAGCCTAAGCTATTTCTGCCTTTAGTCCCATTGGGAAGCAACAGTATTAGTGTTCATGGTGATAGGCAGGTTCTAGGCGATGGGACAGA

GAGGATGTCCCCTTGCTCCCTGTAGTCCTCCCTCCACCTCCTCTTCCCCTCGTTCCTCCCTCATTGTGAGATTCTTTGTGCTCATTTCCCTAGCTGGCTC

CTCCGTGATCTTTTTCCTCCCCATGTAGCTTTTCGTTGTCTTCCTAAAGCGGGGTGTCTCAGTTATGTCTGCTTTTAAGACTACCCAGATACCCCCAATC

CGCTCCCCAGTTCCAGGAAGCTGACATGGGAGCTCAGCCAACCCTGACGTGGAAGGGGCACCCAGCTTGGGGATTCTGAGCCCATTTGGTACTTGATACG

GGGGAGGGGGGGGAATGGAAATGCAGAGCTGATCTCCTTGATTCTGCAAGCCTGGCCCGCAGAGGCAGGCATCTCCTTTTCCCTCTCCTGGCTTCCACCC

CTTGCTGCCCAGATCCACCTTGAGCCGCTCTGCATTTCCCGCTGGCTTGTATGAGGCACTTGCCAGGTGTAAAGGCCGTGGTGGAACAGAGGGCATCATT

GGTCGCTGGGGGAGGTGTGGCTGGCCCCAGCTCAGAAGGGCTTCTAGCTTCTCAAAGTGACCACTGGATTCCTGGAAGGAGTAGCTGTTCTAATTGAGTC

TGGCAGAAAGGATAGAGGTCAGAAGGTTAGGTCTGAAGGGGGAAGATCTGAGGAGAAGTCAAATAGGACCCATTGAGAGGGTAGTTCACCTCTCCAGTCT

CCCTTGTCCTGGCTACAGGACACATTCTGCAGAGATGCTCCCAGGCCCAGTTCAAGCTGCAAGCACAATGTCCTGAGTAGGATTCCTGGTTGGCAGGAGG

AAGGGCAGGATGGCTCTGCCTTTAGTTTTTAGTTTAGTGTTCTGTCCTTCCCTCCTCTTCCATTCACGAGAACGACAGGATTCGATTCCAGGCCTTTCCT

TAGTTCTCTTAGAACCCTCATCTCTCTCTAGACTGATCTTAGTTCCTGGGACTGTATCTTTCAAGCAGGGTGTGGACATTGTCTGGTATCTTATTCCTCT

GCATGAGGCCTGAGGTGGGTAGGCCTTACCAAGGAGCAGCTGGCTGTTTCTCATCTCCTTGCAACAGAAACCCACCTAGGCTAGGGAGACTGGAAAACCA

TACCACATTGGTTTGCCTTGGACCCTAAGACTTGGTTTCAGGCCACCTTGAGCTTTGATTTTTCAGCTTCTTCCTTGTAAGAGAATCCAAGAGTGTCTGG

AAAGTTCCTTTCCTGTTGACTCCCTAGGCTTAGTTGATTCTCTCCCCTACTGTTTTCTCTATGGAGAGCAGTTGTCATAGCTCCTGCTACCCTGAGAGAT

TCTAGGGCTAGGCTCTTCCTCCTCTTCCCTTCTCCCAGCTCCCTTTCTCTTAGTCCTCTGTTACTTCCAGGAAAGCTGTGATCCAGCTGCCAGCCTAGCA

TCCACAGCTGTTGGGTGTTACCCCCAGTCAACTTCCTGTCCTATCGGCCTCTCCTCTTTCCTGGCTCACACCTATTGGCCATGCCTGGCACTGCCCTTGG

GAAAGCCTGTCACCAGTGTCTGGCCCAGCTGCTCAGGCACTGGGATGCTGCATCTTCAGGCAACTATGCACTTTGATGAGGAGAGAGTGAGAGAGATGGG

GCCGGGCACAGATGGTTTGCTTGAGGGGTGGGAGGGCCTGGTGGATGCTGGGAGTCCTCCTGTCTGTCGCCAGCCAGTGACCTGCTTTTGCATTCTCCTG

GTGCCCACTGCCCCTTGTTTCTGAGAGACACAAACTATCCCCTCATTGGCAGTTGACCTGCCCGAGCCAGTGTCTATCTGTGTAACTGGATGAATATAAT

AAAGGGATCATTTGACCCTGT
Translation
 - UNI16024 - MAE - UNI7692 - EKVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWML LNSVTLAVNLVGCLAWLIGGGGATN

FGLAFLWLILFTPCSYVCWFRPIYKAFK KTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVC CGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSF

IALSM VHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM

For any suggestions or comments, please send an email to unitrap@crg.es