Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040725 (Hnrnpul1)
Chromosomal location
Chr 7: 26506517 - 26539749 (-)
Description
heterogeneous nuclear ribonucleoprotein U-like 1 Gene [Source:MGI Symbol;Acc:MGI:2443517]
RefSeq_dna
NM_178089 NM_144922 
RefSeq_peptide
NP_835190.1 NP_659171.1 
UniGene
Mm.254223 
MGI
MGI:2443517 
Uniprot/SWISSPROT
Q8VDM6 
Human Ortholog
ENSG00000105323 (HNRNPUL1)
Omim not available
UniTrap UNI20107
Vector Insertion
Chr 7: 26536010 - 26539359
Public Clones (sanger) CMHD-GT_537H8-5S (cmhd) CMHD-GT_537H8-3 (cmhd) IST14395C3 (tigm)
IST14449E3 (tigm)
Private Clones OST372825 (lexicon) OST369543 (lexicon) OST216133 (lexicon) OST190728 (lexicon)
OST139331 (lexicon) OST139305 (lexicon) OST69801 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26375
Vector Insertion
Chr 7: 26533496 - 26535883
Public Clones not available
Private Clones OST122621 (lexicon) OST101133 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15076
Vector Insertion
Chr 7: 26531366 - 26533496
Public Clones PST13696-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1901
Vector Insertion
Chr 7: 26511923 - 26518034
Public Clones AR0147 (sanger) AY0354 (sanger)
Private Clones OST432578 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2691
Vector Insertion
Chr 7: 26509864 - 26510942
Public Clones AL0352 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7405
Vector Insertion
Chr 7: 26508017 - 26509573
Public Clones RRS612 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108401
Sequence
GGTTTAGGGGGGACAGAGCCCTGGGAGGCCGGGCCAGGCTCGGGGGCCGCCCCGGGGGCCCGGGCCATGGATGTGCGTCGCCTGAAGGTGAACGAACTTC

GCGAGGAGCTGCAGCGCCGCGGCCTGGACACTCGCGGCCTGAAGGCCGAGCTTGCTGAGCGGCTGCTGGCGGCGCTAGAGGCCGAGGAGCCCGAAGACGA

ACGGGAGCTCGAGGCTGACGACGATCCGGGGTTACCTGGGCACAACAACGAGGAGGTCGAGACCGAGGGGGGCTCCGAGCTGGAGGGGACCGCGCAGCCA

CCGCCGCCCGGGCTGCAGCCGCACCCGGAGCCCGGCGGCTACTCGGGGCCGGACGGACATT - UNI20107 - ATGTCATGGACAATATTACCAGACA

GAACCAATTCTACGAGACACCAGTCATCAAGCAAGAAAATGAGTCAAGCTATGATAGGAGACCACTAGACATGGAGCCACAGCAGCAAGTATATCACCCA

G - UNI15076 - - UNI26375 - AATTGAAGACAGAAATGAAGCAAGAAGCCCCACCCAGCTTCCTCCCCCCTGAAGCCTCACAGCTCAAGACAG

ACAGACCACAATTCCAGAATCGAAAGAGGCCCTTTGAAGAGAATCGAGGCCGTGGGTACTTCGAGCACCGAGAGGATCGAAG - UNI15076 - GGGC

CGCTCTCCTCAGCCTCCTGCTGAAGAGGATGAAGATGACTTTGATGATACACTTGTGGCCATTGACACAT - UNI15076 - ATAACTGTGACCTGCA

CTTCAAAGTGGCCCGAGACCGGAGTAGTGGCTATCCATTGACGATTGAGGGCTTTGCATACCTGTGGTCAGGAGCCCGTGCCAGCTATGGGGTCAGAAGA

GGGCGTGTGTGTTTTGAAATGAAG ATCAATGAGGAAATCTCCGTGAAGCATCTTCCATCTACAGAGCCCGACCCCCACGTTGTCCGTATTGGCTGGTCC

TTGGACTCTTGCAGCACTCAGCTAG GTGAAGAGCCTTTTTCCTATGGTTATGGAGGCACAGGGAAGAAGTCTACCAATAGCCGCTTTGAAAACTACGGA

GACAAATTTGCTGAGAACGATGTGATTGGCTGCTTTGCG GTACTGGAATTGCAGGTGTGAGCCATTATACCAGCAAGGAGCTTTCTCTTGAAAAGTTTA

CACACTCGTGGCTATGAACATGTCTTTTCCTGTGCATCTTTCTTTCCCTTAACATCCATACTTAAACTTGTAGTCAAACTTTTTGAATAAAATGTAGCTC

TGCTT
Translation
MDVRRLKVNELREELQRRGLDTRGLKAELAERLLAALEAEEPEDERELEADDDPGLPGHNNEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHY 

- UNI20107 - YVMDNITRQNQFYETPVIKQENESSYDRRPLDMEPQQQVYHPE - UNI15076 - - UNI26375 - ELKTEMKQEAPPSFLPP

EASQLKTDRPQFQNRKRPFEENRGRGYFEHREDRR - UNI15076 - RGRSPQPPAEEDEDDFDDTLVAIDTY - UNI15076 - YNCDLHFKVAR

DRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMK INEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLG GEEPFSYGYGGTGKKSTNSRFENYGDKF

AENDVIGCFA VLELQV
Transcript ENSMUST00000043765
Sequence
CTTTTCCCCCTTCGCCTCCTGACAGGCAAGGTTTAGGGGGGACAGAGCCCTGGGAGGCCGGGCCAGGCTCGGGGGCCGCCCCGGGGGCCCGGGCCATGGA

TGTGCGTCGCCTGAAGGTGAACGAACTTCGCGAGGAGCTGCAGCGCCGCGGCCTGGACACTCGCGGCCTGAAGGCCGAGCTTGCTGAGCGGCTGCTGGCG

GCGCTAGAGGCCGAGGAGCCCGAAGACGAACGGGAGCTCGAGGCTGACGACGATCCGGGGTTACCTGGGCACAACAACGAGGAGGTCGAGACCGAGGGGG

GCTCCGAGCTGGAGGGGACCGCGCAGCCACCGCCGCCCGGGCTGCAGCCGCACCCGGAGCCCGGCGGCTACTCGGGGCCGGACGGACATT - UNI2010

7 - ATGTCATGGACAATATTACCAGACAGAACCAATTCTACGAGACACCAGTCATCAAGCAAGAAAATGAGTCAAGCTATGATAGGAGACCACTAGACA

TGGAGCCACAGCAGCAAGTATATCACCCAG - UNI15076 - - UNI26375 - AATTGAAGACAGAAATGAAGCAAGAAGCCCCACCCAGCTTCCT

CCCCCCTGAAGCCTCACAGCTCAAGACAGACAGACCACAATTCCAGAATCGAAAGAGGCCCTTTGAAGAGAATCGAGGCCGTGGGTACTTCGAGCACCGA

GAGGATCGAAG - UNI15076 - GGGCCGCTCTCCTCAGCCTCCTGCTGAAGAGGATGAAGATGACTTTGATGATACACTTGTGGCCATTGACACAT 

- UNI15076 - ATAACTGTGACCTGCACTTCAAAGTGGCCCGAGACCGGAGTAGTGGCTATCCATTGACGATTGAGGGCTTTGCATACCTGTGGTCAG

GAGCCCGTGCCAGCTATGGGGTCAGAAGAGGGCGTGTGTGTTTTGAAATGAAG ATCAATGAGGAAATCTCCGTGAAGCATCTTCCATCTACAGAGCCCG

ACCCCCACGTTGTCCGTATTGGCTGGTCCTTGGACTCTTGCAGCACTCAGCTAG GTGAAGAGCCTTTTTCCTATGGTTATGGAGGCACAGGGAAGAAGT

CTACCAATAGCCGCTTTGAAAACTACGGAGACAAATTTGCTGAGAACGATGTGATTGGCTGCTTTGCG GACTTTGAATGTGGAAATGATGTGGAGCTTT

CTTTTACCAAGAATGGCAAGTGGATGGGCATTGCCTTCCGAATCCAGAAAGAGGCCTTAGGGGGTCAGGCCCTCTATCCTCATGTCCTGGTGAAGAATTG

TGCTGTGGAATTTAACTTTGGGCAGAGAGCGGAGCCCTACTGCTCTGTCCTCCCAGGGTTCACATTCATCCAGCACCTCCCCCTCAGTGAGCGGATACGG

GGCACCATTGGGCCAAAGAGCAAAGCAGAGTGTGAG ATTCTGATGATGGTAGGCCTGCCTGCTGCTGGCAAGACCACGTGGGCCATCAAACACGCTGCC

TCCAACCCTTCCAAGAAGTACAACATTCTGGGTACCAATGCCATCATGGATAAGATGCGG GTGATGGGCCTGCGGAGGCAGCGGAACTATGCTGGTCGC

TGGGATGTCCTGATCCAGCAGGCCACTCAGTGCCTCAACCGTCTTATTCAGATCGCTGCCCGAAAGAAGCGAAACTATATCCTAGATCAG - UNI1901

 - ACCAATGTTTATGGGTCAGCCCAGAGACGGAAAATGAGACCGTTTGAAGGCTTCCAGCGGAAAGCTATTGTAATCTGTCCAACTGATGAGGACCTCA

AAGACCGCACAGTAAAGCGAACGGACGAAGAAGGGAAGGATGTCCCAGATCACGCAGTCTTAGAAATGAAAG CCAACTTCACTTTGCCTGATGTCGGGG

ACTTCCTGGATGAGGTTCTGTTCATTGAGCTCCAGCGGGAGGAGGCAGACAAGCTGGTGAGGCAATACAACGAGGAAGGCCGGAAGGCCGGCCCGCCCCC

TGAGAAGCGCTTTGACAGCAGAGGCGGAGGCTTCCGAGGCCGTGGGGGCGGCGGCGGTTTCCAGCGGTATGACAACCGAGGCCCTCCTGGAGGCAACCGA

GGAGGCTTCCAGAACCGGGGAGGTGGTGGTGGCAGCGGTGGTGGAGGAGGCAACTACCGAGGAG - UNI2691 - GTTTCAACCGCAGCGGAGGTGGT

GGCTACAACCAAAACCGCTGGGGTAATAACAACAGGGATAACAACAACTCCAACAACCGAGGCAACTATAACCGGGCTCCTCAGCAACAGCCACCACCAC

AACAGCCACCGCCACCACAACCACCACCACAACAACCACCACCACCACCTAGCTATAGCCCTGCTCGGAACCCTCCGGGAGCCAGCAGCTACAACAAAAA

CAGCAACATCCCTGGCTCCAGCGCCAATACCAGCACCCCTACAGTGAGCAGCTACACCCCTCCACAG - UNI7405 - CCGAGTTACAGCCAGCCACC

CTACAACCAAGGAGGCTACACCCAGGGCTACACAGCCCCACCACCTCCACCTCCGCCACCACCTGCCTACAACTATGGGAGCTATGGCCCCTACAATCCT

GCCCCCTATACACCCCCACCACCCCCAACTGCCCAGACCTACCCTCAGCCCAGCTATAACCAGTATCAGCAG TATGCCCAGCAGTGGAGCCAGTACTAT

CAGAACCAGAGCCAGTGGCCGCCATACTACGGGAACTACGACTATGGAGGCTACTCGGGCAGCACACAGGGGGGCACAAGCACACAGTAGCCGGTGCTGG

AGCCTTCAGAGGCTCGTGCCGGCTGCTTCTAATAGCACCTGCCTTGGCCCCTTTTTCCCCTCTGAGTCCTGTGGTGCTGGGGACAGAGTTATCCCAGGGC

TGCCTCTCTCTAGCCCACTTTTTCCAGAGGAGCTTCTCTCTTCATACAGGCCAGGCATTTTCCTCTCTGGATTCCAACAGGCAACAGTGAGCTTTTCTTT

TATCTTTGTCCCTCCACTTCCTCCTCCCCTGCCTTCTTAGCTAAAGAAGCCTCCCTTGTGAGGCCACAGTGACTGGGGAGGAGCCTTGCCTGTCTGCCCC

TCCCTACTCTGCTTTTTAGCCCCTTGGCTTCCCAGACTCTCATGCAGTTGGTTGTAAATTCTTCCAGGAGCTGTTTTTCTGTCTACTTTTCAGGATTTAA

AAAAAATTTTTTTCAAAAACTTTAAAAAAAAAAAAAGTTTAAGAAGCAAATTGCAGAGGGAGGAAGCATTGACTTTTTTTGGTAATTATGCTTTTTTTTT

TTTTTTTTTAATTTTTAGAATTTGTCTGTTTTTACTGTGGGTCAGCCGTTGATACTTCATCAAATAACCATTTCTTTGCTGAGTTCAGGTAACCGAGGAA

GAGCCACACCCTCGAAACAACAAAATCACCTTTAACCTAACTTTTTATATGATGTCTCAGTTCCCCGTAACTTTGCACACAAGCGTCTGTTCAGTTGGAT

TGTAACTGCTTTTTGTACTTGGAGAGAGTGTGACTATTG
Translation
MDVRRLKVNELREELQRRGLDTRGLKAELAERLLAALEAEEPEDERELEADDDPGLPGHNNEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHY 

- UNI20107 - YVMDNITRQNQFYETPVIKQENESSYDRRPLDMEPQQQVYHPE - UNI15076 - - UNI26375 - ELKTEMKQEAPPSFLPP

EASQLKTDRPQFQNRKRPFEENRGRGYFEHREDRR - UNI15076 - RGRSPQPPAEEDEDDFDDTLVAIDTY - UNI15076 - YNCDLHFKVAR

DRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMK INEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLG GEEPFSYGYGGTGKKSTNSRFENYGDKF

AENDVIGCFA DFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTIGPKSKAECE

 ILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMR VMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQ - UNI1901 - T

NVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTVKRTDEEGKDVPDHAVLEMKA ANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPP

EKRFDSRGGGFRGRGGGGGFQRYDNRGPPGGNRGGFQNRGGGGGSGGGGGNYRGG - UNI2691 - GFNRSGGGGYNQNRWGNNNRDNNNSNNRGNYN

RAPQQQPPPQQPPPPQPPPQQPPPPPSYSPARNPPGASSYNKNSNIPGSSANTSTPTVSSYTPPQ - UNI7405 - PSYSQPPYNQGGYTQGYTAPPP

PPPPPPAYNYGSYGPYNPAPYTPPPPPTAQTYPQPSYNQYQQ YAQQWSQYYQNQSQWPPYYGNYDYGGYSGSTQGGTSTQ

For any suggestions or comments, please send an email to unitrap@crg.es