Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040749 (Siah1b)
Chromosomal location
Chr X: 160508635 - 160514082 (-)
Description
seven in absentia 1B Gene [Source:MGI (curated);Acc:Siah1b-002]
RefSeq_dna
NM_009173 
RefSeq_peptide
NP_033199.1 
UniGene
Mm.379013 Mm.37215 
MGI
MGI:108063 
Uniprot/SWISSPROT
Q06985 
Uniprot/SPTREMBL
A2AHZ2 A2AHZ3 
Human Ortholog
not available
Omim not available
UniTrap UNI26185
Vector Insertion
Chr X: 160513602 - 160513946
Public Clones not available
Private Clones OST132082 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI433
Vector Insertion
Chr X: 160511283 - 160513509
Public Clones DD0495 (sanger) P124B03 (ggtc) D171E09 (ggtc) (ggtc) E025G12 (ggtc)
IST14417G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19526
Vector Insertion
Chr X: 160510160 - 160511221
Public Clones not available
Private Clones OST389662 (lexicon) OST42381 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037928
Sequence
ACTACCCCTTTGGCCTTTACACGCACTGTCTTGAG - UNI26185 - ATCGAGAGACCAGGAACTTCAAAATAGTGCCTGGGATCCGGATGACAGCAG

GCATTAAGGGCTGGCTACTGGACTGAAGCTGCTGGAAACTT - UNI433 - GGGAAGACCAGGTGTACACTCAAGACCTAGAATGACCAAGAATGTGG

AACCTTAAAAAAAG - UNI19526 - GGTGGCGGCCCAGGGTGTCCCATAGGTCTCCGTGCGACTAGGAGGGGCAGCGGTGGCGGCGGTGGCAGCGGC

AGCAGCGGCAGCGGCGGCAGCGGCAGCAGCAGCAGCTAGCAACCTGGTCAGGGTACGCTCTCCATCCACAGAGATGAGCCGTCAGGCTGCTACAGCATTA

TCCACTGGCACCTCAAAGTGTCCACCATCCCAGAGGGTACCTGCCTTGACTGACACAACTGCATCCAACAATGACTTGGCGAGTCTTTTTGAGTGTCCTG

TCTGCTTTGACTATGTGTTGCCACCTATTCTTCAGTGTCAGAGTGGCCATCTTGTTTGTAGCAACTGTCGCCCCAAACTTACATGTTGTCCCACCTGCCG

GGGCCCATTGGGATCCATTCGCAACTTGGCTATGGAGAAAGTGGCCAACTCAGTACTCTTCCCCTGTAAATATTCCGCTTCTGGATGTGAAATAACTCTG

CCACACACCAAAAAGGCAGAGCACGAGGAGCTGTGTGAGTTCAGGCCTTACTCCTGCCCCTGCCCTGGTGCTTCCTGTAAATGGCAAGGCTCCTTGGATG

CTGTCATGCCCCACCTGATGCATCAGCACAAGTCCATTACCACCCTGCAAGGAGAAGACATAGTTTTCCTTGCTACAGACATCAACCTTCCTGGTGCTGT

TGACTGGGTGATGATGCAGTCTTGTTTTGGCTTTCATTTCATGTTAGTCTTGGAGAAACAGGAAAAATATGATGGTCATCAGCAGTTCTTTGCAATTGTA

CAACTGATAGGAACACGCAAACAAGCTGAAAATTTTGCCTATCGACTTGAGCTAAATGGTCATAGGCGCCGATTAACTTGGGAAGCGACTCCTCGATCTA

TTCATGAGGGGATTGCAACAGCCATTATGAATAGTGATTGCCTAGTGTTTGACACCAGCATTGCACAGCTTTTTGCAGAAAATGGTAATCTAGGCATCAA

TGTAACTATTTCCATGTGTTGAAACGGCAATCAAATATTTCTGGCCAGTGTTTAAAATTTGCATTTGACTTCACAGAGAATAAGCCACCCATCTGCCTGC

CAACCTAAAACATTCCTGGTAGGTAGAAGCTAGACATGAAGGTAAAGAAAAAGAAAAGCTGTTAATACAGGAAACAGTTGCATGTAGTAACACTAATAGA

TTTAAAAATAATTCAACAGTAAACCACTGAAAAACCATATATACTCAAGATGGGCATCTTTTGTATTAAGAAAGGAAACGTTGTAAAATATTTCTGAACT

TTGTATTTGTTGTAGATTGATTGTATTGTTGACAATTTTTCGGGGTGGGGGTGTGCCTGCACACATGCGTGCACGTGTGTGCTTGGTTTTCCTTTAACAA

GCCATCTACGTGTCATAGCCCACTGTTTTCCCCTTGTGAGTCAACACATAGTGCTGCTGTGGTTTTGGTTTGGTTTGCTTTTGGTTTTTGATGTGTGTGT

ATTTGATAATTTTTATTCTAGTTTTTCATTAAATAAATTTGACTTTTCTGTCA
Translation
 - UNI26185 -  - UNI433 -  - UNI19526 - MSRQAATALSTGTSKCPPSQRVPALTDTTASNNDLASLFECPVCFDYVLPPILQCQSGHL

VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYSASGCEITLPHTKKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQG

EDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFD

TSIAQLFAENGNLGINVTISMC
Transcript ENSMUST00000071667
Sequence
GCCTCGTGCCGGGAGCCCGCGCGGAGGTTGAATTCG - UNI26185 - ATCGAGAGACCAGGAACTTCAAAATAGTGCCTGGGATCCGGATGACAGCA

GGCATTAAGGGCTGGCTACTGGACTGAAGCTGCTGGAAACTT - UNI433 - GGGAAGACCAGGTGTACACTCAAGACCTAGAATGACCAAGAATGTG

GAACCTTAAAAAAAG - UNI19526 - GGTGGCGGCCCAGGGTGTCCCATAGGTCTCCGTGCGACTAGGAGGGGCAGCGGTGGCGGCGGTGGCAGCGG

CAGCAGCGGCAGCGGCGGCAGCGGCAGCAGCAGCAGCTAGCAACCTGGTCAGGGTACGCTCTCCATCCACAGAGATGAGCCGTCAGGCTGCTACAGCATT

ATCCACTGGCACCTCAAAGTGTCCACCATCCCAGAGGGTACCTGCCTTGACTGACACAACTGCATCCAACAATGACTTGGCGAGTCTTTTTGAGTGTCCT

GTCTGCTTTGACTATGTGTTGCCACCTATTCTTCAGTGTCAGAGTGGCCATCTTGTTTGTAGCAACTGTCGCCCCAAACTTACATGTTGTCCCACCTGCC

GGGGCCCATTGGGATCCATTCGCAACTTGGCTATGGAGAAAGTGGCCAACTCAGTACTCTTCCCCTGTAAATATTCCGCTTCTGGATGTGAAATAACTCT

GCCACACACCAAAAAGGCAGAGCACGAGGAGCTGTGTGAGTTCAGGCCTTACTCCTGCCCCTGCCCTGGTGCTTCCTGTAAATGGCAAGGCTCCTTGGAT

GCTGTCATGCCCCACCTGATGCATCAGCACAAGTCCATTACCACCCTGCAAGGAGAAGACATAGTTTTCCTTGCTACAGACATCAACCTTCCTGGTGCTG

TTGACTGGGTGATGATGCAGTCTTGTTTTGGCTTTCATTTCATGTTAGTCTTGGAGAAACAGGAAAAATATGATGGTCATCAGCAGTTCTTTGCAATTGT

ACAACTGATAGGAACACGCAAACAAGCTGAAAATTTTGCCTATCGACTTGAGCTAAATGGTCATAGGCGCCGATTAACTTGGGAAGCGACTCCTCGATCT

ATTCATGAGGGGATTGCAACAGCCATTATGAATAGTGATTGCCTAGTGTTTGACACCAGCATTGCACAGCTTTTTGCAGAAAATGGTAATCTAGGCATCA

ATGTAACTATTTCCATGTGTTGAAACGGCAATCAAATATTTCTGGCCAGTGTTTAAAATTTGCATTTGACTTCACAGAGAATAAGCCACCCATCTGCCTG

CCAACCTAAAACATTCCTGGTAGGTAGAAGCTAGACATGAAGGTAAAGAAAAAGAAAAGCTGTTAATACAGGAAACAGTTGCATGTAGTAACACTAATAG

ATTTAAAAATAATTCAACAGTAAACCACTGAAAAACCATATATACTCAAGATGGGCATCTTTTGTATTAAGAAAGGAAACGTTGTAAAATATTTCTGAAC

TTTGTATTTGTTGTAGATTGATTGTATTGTTGACAATTTTTCGGGGTGGGGGTGTGCCTGCACACATGCGTGCACGTGTGTGCTTGGTTTTCCTTTAACA

AGCCATCTACGTGTCATAGCCCACTGTTTTCCCCTTGTGAGTCAACACATAGTGCTGCTGTGGTTTTGGTTTGGTTTGCTTTTGGTTTTTGATGTGTGTG

TATTTGATAATTTTTATTCTAGTTTTTCATTAAATAAATTTGACTTTTCTGT
Translation
 - UNI26185 -  - UNI433 -  - UNI19526 - MSRQAATALSTGTSKCPPSQRVPALTDTTASNNDLASLFECPVCFDYVLPPILQCQSGHL

VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYSASGCEITLPHTKKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQG

EDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFD

TSIAQLFAENGNLGINVTISMC

For any suggestions or comments, please send an email to unitrap@crg.es