Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040812 (Agbl2)
Chromosomal location
Chr 2: 90622884 - 90674576 (+)
Description
ATP/GTP binding protein-like 2 Gene [Source:MGI (curated);Acc:Agbl2-004]
RefSeq_peptide
NP_848870.2 
UniGene
Mm.61146 
MGI
MGI:2443254 
Uniprot/SWISSPROT
Q8CDK2 
Human Ortholog
ENSG00000165923 (AGBL2)
Omim not available
UniTrap UNI35168
Vector Insertion
Chr 2: 90622918 - 90623394
Public Clones IST14982F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36185
Vector Insertion
Chr 2: 90629990 - 90631616
Public Clones IST13000A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22026
Vector Insertion
Chr 2: 90631803 - 90634029
Public Clones not available
Private Clones OST311169 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21207
Vector Insertion
Chr 2: 90656532 - 90668266
Public Clones IST14623H4 (tigm) IST11942E5 (tigm) IST14327B7 (tigm) IST10579C12HMF2 (tigm)
IST10579C12 (tigm)
Private Clones OST338719 (lexicon) OST79968 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037206
Sequence
ACCCGGTTCCTTTCCCTTTTCTGCGGCGTCCTGGTGTTGGGCATCTGTTCTCAGCGTAAACTAAGCATGGGGCCAATGAGGCTCCTGGTGAATCTAGTGG

ACCAGGCGTGGGGACACGCAGAGCGCCCCAGCTCCTCAG GCAGATATTGCAGCTGGGTACGGTGCTACTAACTCGCCTACATCATACTATGCGGCAGTA

ACATGTTCCCGGCGTTGGAAACAGAACTAAAGCCGGAG ACTCTTCCTGATCCCTATGAGGACTTTATTCACCATCACCTCCAGTATTATGGATATTTCA

AAG CTCAGAAAAGCAGCCTGCCAAACTCAGGCACTCATCAGCGCGTTTGGAGGAACAGCCCTCGGTACATGTTGAATGGCTCTTTTGGAGAAAGAGATG

ATTTCATCTCGGACAGTTTGGAAAAAGAGATGCTTCTGT GGCCTACCTGTTTATCTTCAACTGGGCATGCTCACATAGACGCTGTAAACAGAG - UNI

36185 - ACTCACTTCTGCTGAGCTCGCCGCTCCTGAGGACCAGGCAGCTGATTTTTGATGAGCTAGATGAAGCAAGCCCACGGCTTCGAGAACCCCGA

GAACTCTTCTCATGTTTCTCTAGCAGAGGGCCGCTGCAGGCTCCAAGATGGCCAATCGAATGTGAGGTCATCAAGGAAAACATTCATCACATTG - UNI

22026 - AGTGGGTTCCACATCAACCAGAATATTTCTACCAACCTACAGGAAGCGAGAAGGTGCCAGAGATTGTGGGAGAGGAGCAAGGTACAGTTGTG

TACCAGCTAGATTCAG TGCCTGCAGAAGGCACCTATTTCACTAGTTCCAGAATAGGAGGCAAACGAGGGACCATCAAGGAACTTGCTGTCACACTGCAA

GGGCCGGACGACAATACTCTATTGTTTGAGTCAAGGTTTGAGAGCGGGAATCTGCAGAAAGCCGTCAGAGT AGGTATCTATGAGTACGAGCTCACCTTG

CGGACTGACCTCTACACGGACAAACACACTCAGTGGTTTTACTTCAGAGTTCAGAACACCAGAAAAGACGCTACCTATCGCTTCACCATCGTCAACTTGC

TGAAACCCAAGAGCCTTTACGCAGTAGGCATGAAGCCTCTCATGTACTCTCAGCTGGATGCCACCATCTACAACATCGGCTGGAGGAGAGAGGGCCGTGA

AATCAAGTACTACAAGAACAATGTGGACGACGGCCAGCAGCCCTTATACTGCCTCACCTGGACCACTCAGTTTCCTCACGACCAGGACACTTGCTTCTTC

GCACACTTTTACCCATACACTTATACTGACTTGCAATGCTATCTCTTGTCAGTAGCAAACAACCCCATCCAGTCTCAGTTCTGCAAGCTCCGAGCCCTAT

GCAGGAGCCTAGCAGGGAACACTGTCTACCTGCTGACCATCACCAACCCATCCAGGACCCCTCAAGAGGCAGCCGCAAAGAAAGCTGTGGTCTTGAGCGC

CCGAGTCCACCCTGGAGAGAGTAACAGCTCCTGGATCATGAACGGCTTTTTGGACTTCATCCTTAGCAACTCTCCCGATGCCCAGCTCCTCAGGGATATC

TTTGTCTTCAAGGTGATTCCCATGTTAAACCCAGATGGCGTGATAGTGGGGAACTATCGGTGTTCGCTGGCTGGAAGGGACTTGAACAGGCATTATAAAA

CCGTTCTTAAGGACTCCTTCCCTTGCATTTGGTACACCAAGAACATGATCAAAAG GCTTCTGGAAGAAAGAGAGGTTCTCTTGTACTGTGATTTCCATG

GGCATAGCCGCAAGAACAACATCTTCCTGTATGGCTGTCACAGCAACAACCGCAAGCACTGGCTCCATGAGCGTGTCTTTCCTTTAATGTTGAGCAAGAA

TGCACCAGACAAG TTCTCTTTCGACAGCTGTAACTTTAAGGTCCAAAAATGCAAAGAAGGAACGGGAAGAGTGGTGATGTGGCGGATGGGCATCATCAA

CAGCTACACCATGGAGTCTACCTTTGGCGGGTCTACCCTGG GTAGTAAAAGAGACACTCACTTTACCATTGAGGACCTGAAGTCCCTAGGGTATCATGT

CTGTGACACTCTTCTGGATTTCTGTGATCCTGACCAAACCAAG TACACACAGTGTCTACAAGAGCTTAAGGAGCTCCTACAACAGGAAATCAACAAAAA

GTTGAATAACTTTGGACAAGATATGGATTTAGAAGGAAACTGGAGTGACATTCCTTTGTCTGACATTGAATCCAG CACGAGTGGCTCGGACAGCTCCCT

CTCCGATGGCCCTCCCATTCGTCTACTGAACATCGTTGCAGATGAG CCAAATCAGAAGACGGTGTTAAAGAATCCAAAAAAGAAGAGACTTCAGACTAG

AAAACAGCGGAATGAGCAGTACCAGAAGAGCTACTTGATGCGGGAGTTAAAGTTAACAGAAAACGCCCCA GGAAGGGCGAGATTTGTCTCTACTCTGCA

AAAGCAGCCTACTTTTTTGAAAAGTCCAGAGAGTCCTAGCCCTTCAGTAAGGAGAAGTGAAAACCCAAGGCTCAATGAG ACACAGTTAAGTGGAAGAGA

GAAGGGCACCTCCCTGGATCCACCACTGACCAGCCCTAAGAATAAAGAAAGAATTCAG GGTTTCTCTACATAGCCCTGGCTGTCCTGGAACTCACCATC

TAGACCAGGCTGAAGCCTGCCTCTGCCTCCCAAGTGCTTCAAGTGCATAGCAGCCTCACTATATAACAGTTTTTTCAGTAATTAATAAAGTCCCACAAAA

TAGCCC
Translation
 MFPALETELKPE TLPDPYEDFIHHHLQYYGYFKA AQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLW WPTCLSSTGHAHIDAV

NRD - UNI36185 - DSLLLSSPLLRTRQLIFDELDEASPRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIE - UNI22026 - EWVPHQ

PEYFYQPTGSEKVPEIVGEEQGTVVYQLDSV VPAEGTYFTSSRIGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRV VGIYEYELTLRTDLY

TDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPLYCLTWTTQFPHDQDTCFFAHFYP

YTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKV

IPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKR RLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKHWLHERVFPLMLSKNAPD

K FSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLG GSKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQTK YTQCLQELKELLQQEINKK

LNNFGQDMDLEGNWSDIPLSDIESS STSGSDSSLSDGPPIRLLNIVADE PNQKTVLKNPKKKRLQTRKQRNEQYQKSYLMRELKLTENAP GRARFVS

TLQKQPTFLKSPESPSPSVRRSENPRLNE TQLSGREKGTSLDPPLTSPKNKERIQ GFST
Transcript ENSMUST00000051831
Sequence
AGGCTCCCAGGGTCCTCGCAGAAAACTCCAGCAG - UNI35168 - CTGTTTGGAAATCAGGCAGATATTGCAGCTGGGTACGGTGCTACTAACTCGC

CTACATCATACTATGCGGCAGTAACATGTTCCCGGCGTTGGAAACAGAACTAAAGCCGGAG CGTGTTTGGTGCTTTTGGTTAAGAAGTCAGTGTCATCT

GAATGAATGTCCTGCTTGAGATGGCTTTTCTTTCACAGACTCTTCCTGATCCCTATGAGGACTTTATTCACCATCACCTCCAGTATTATGGATATTTCAA

AG CTCAGAAAAGCAGCCTGCCAAACTCAGGCACTCATCAGCGCGTTTGGAGGAACAGCCCTCGGTACATGTTGAATGGCTCTTTTGGAGAAAGAGATGA

TTTCATCTCGGACAGTTTGGAAAAAGAGATGCTTCTGT GGCCTACCTGTTTATCTTCAACTGGGCATGCTCACATAGACGCTGTAAACAGAG - UNI3

6185 - ACTCACTTCTGCTGAGCTCGCCGCTCCTGAGGACCAGGCAGCTGATTTTTGATGAGCTAGATGAAGCAAGCCCACGGCTTCGAGAACCCCGAG

AACTCTTCTCATGTTTCTCTAGCAGAGGGCCGCTGCAGGCTCCAAGATGGCCAATCGAATGTGAGGTCATCAAGGAAAACATTCATCACATTG - UNI2

2026 - AGTGGGTTCCACATCAACCAGAATATTTCTACCAACCTACAGGAAGCGAGAAGGTGCCAGAGATTGTGGGAGAGGAGCAAGGTACAGTTGTGT

ACCAGCTAGATTCAG TGCCTGCAGAAGGCACCTATTTCACTAGTTCCAGAATAGGAGGCAAACGAGGGACCATCAAGGAACTTGCTGTCACACTGCAAG

GGCCGGACGACAATACTCTATTGTTTGAGTCAAGGTTTGAGAGCGGGAATCTGCAGAAAGCCGTCAGAGT AGGTATCTATGAGTACGAGCTCACCTTGC

GGACTGACCTCTACACGGACAAACACACTCAGTGGTTTTACTTCAGAGTTCAGAACACCAGAAAAGACGCTACCTATCGCTTCACCATCGTCAACTTGCT

GAAACCCAAGAGCCTTTACGCAGTAGGCATGAAGCCTCTCATGTACTCTCAGCTGGATGCCACCATCTACAACATCGGCTGGAGGAGAGAGGGCCGTGAA

ATCAAGTACTACAAGAACAATGTGGACGACGGCCAGCAGCCCTTATACTGCCTCACCTGGACCACTCAGTTTCCTCACGACCAGGACACTTGCTTCTTCG

CACACTTTTACCCATACACTTATACTGACTTGCAATGCTATCTCTTGTCAGTAGCAAACAACCCCATCCAGTCTCAGTTCTGCAAGCTCCGAGCCCTATG

CAGGAGCCTAGCAGGGAACACTGTCTACCTGCTGACCATCACCAACCCATCCAGGACCCCTCAAGAGGCAGCCGCAAAGAAAGCTGTGGTCTTGAGCGCC

CGAGTCCACCCTGGAGAGAGTAACAGCTCCTGGATCATGAACGGCTTTTTGGACTTCATCCTTAGCAACTCTCCCGATGCCCAGCTCCTCAGGGATATCT

TTGTCTTCAAGGTGATTCCCATGTTAAACCCAGATGGCGTGATAGTGGGGAACTATCGGTGTTCGCTGGCTGGAAGGGACTTGAACAGGCATTATAAAAC

CGTTCTTAAGGACTCCTTCCCTTGCATTTGGTACACCAAGAACATGATCAAAAG GCTTCTGGAAGAAAGAGAGGTTCTCTTGTACTGTGATTTCCATGG

GCATAGCCGCAAGAACAACATCTTCCTGTATGGCTGTCACAGCAACAACCGCAAGCACTGGCTCCATGAGCGTGTCTTTCCTTTAATGTTGAGCAAGAAT

GCACCAGACAAG TTCTCTTTCGACAGCTGTAACTTTAAGGTCCAAAAATGCAAAGAAGGAACGGGAAGAGTGGTGATGTGGCGGATGGGCATCATCAAC

AGCTACACCATGGAGTCTACCTTTGGCGGGTCTACCCTGG GTAGTAAAAGAGACACTCACTTTACCATTGAGGACCTGAAGTCCCTAGGGTATCATGTC

TGTGACACTCTTCTGGATTTCTGTGATCCTGACCAAACCAAG TACACACAGTGTCTACAAGAGCTTAAGGAGCTCCTACAACAGGAAATCAACAAAAAG

TTGAATAACTTTGGACAAGATATGGATTTAGAAGGAAACTGGAGTGACATTCCTTTGTCTGACATTGAATCCAG CACGAGTGGCTCGGACAGCTCCCTC

TCCGATGGCCCTCCCATTCGTCTACTGAACATCGTTGCAGATGAG CCAAATCAGAAGACGGTGTTAAAGAATCCAAAAAAGAAGAGACTTCAGACTAGA

AAACAGCGGAATGAGCAGTACCAGAAGAGCTACTTGATGCGGGAGTTAAAGTTAACAGAAAACGCCCCA GGAAGGGCGAGATTTGTCTCTACTCTGCAA

AAGCAGCCTACTTTTTTGAAAAGTCCAGAGAGTCCTAGCCCTTCAGTAAGGAGAAGTGAAAACCCAAGGCTCAATGAG ACACAGTTAAGTGGAAGAGAG

AAGGGCACCTCCCTGGATCCACCACTGACCAGCCCTAAGAATAAAGAAAGAATTCAG TCATACAGCCAGCCATGTGTTTTTTCCTTGATCCTTCATGAG

CACCAAGCACAGACGTCCAGCGACACGCCCTGTCAGAATCCAGAGTCCCATTAAAGACGAGTCACTCAG - UNI21207 - AAGGCCTAACCCCATAG

TTCCTGCCCCACGTCTGGCCTTTAATATACAACAACCATATGTCAGACTGAACTACTCAACACCAAGACGACGTCCGATCCATCTCTTAGGGTTGCCTGA

CCTTCATCTTTTGGGCAGATGAGGAAGGACAAGCATTTGGATATAGAAAATGGGTGAAAGGTCACAGAAATGAAAAAACCAAAATTCTGCCTGCACTTAG

CTATCTGCCAGTACAAAATTAACAACTGAAGATACAGGGACACATCTTCAAACAATGTAAAGGAAGGTCACCCCAATATCTCTCTCTTTCAGTCCAAGAA

ATGGCTTTTATCTCTAACAGCAATGAACTATATACAGTAAGAACAATTCTGACAACTATCAG TGTTGCACTTTACTGGATGCATATGCTGGCGCATTAT

CAGTTTTCGTCTGTAAAGTACCCCTCAGAGAGTCATCACCTCTACTATATAATTACAGAATCAGCCTTTCCAGGACTCAAAGCAGAAGCCCATTGGAATC

CTGA GTGTTGTCTTTGCTCGCGGTGAGAGAAGGGGGCATCAGCACAGGCTCTGGGCCTCGGCTTCTTATTCCAGAGAGGAGCACTGCAGCTCTGGAAAG

 TCCCACTTCTTGCTCCAGGCCATCAGCTCTTTATTGGGCGACAAGCATATTCAGTCTGAACCGACCAGCAGCAAGACGACACCTATTCATGTCTGAGGG

TTGTTTTTAGGCAGTGAAAGTTGCCTGACCTTCTTTTGGGCAGGTGAAGAAGCACAAGCATCTACACAGGGAAAACCAGGGATGAGCCACAGAAATGACA

ATACCAAAATTCTGTCAACACTTAGGTTCTCTGCCAGTACATAACTAACAAGTGAAAATACAGGGACACATCCTTTGAACATTGTAAAGAAAGGTCACCC

CAACAAGTTCTCATTACCATGAAAGAAAGATAAATGAAGGAAGAAAGGACAGAAGGAATTGTTGCTTCCAGTGGGACGGCACATACCTGTAATTAAAGCA

CGCTGTCTCAAAAACTAACAAACAAATAAATAT
Translation
 - UNI35168 -  MNVLLEMAFLSQTLPDPYEDFIHHHLQYYGYFKA AQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLW WPT

CLSSTGHAHIDAVNRD - UNI36185 - DSLLLSSPLLRTRQLIFDELDEASPRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIE - UNI2

2026 - EWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSV VPAEGTYFTSSRIGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRV VG

IYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPLYCLTWTTQFP

HDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSP

DAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKR RLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKHWLHE

RVFPLMLSKNAPDK FSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLG GSKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQTK YTQCLQ

ELKELLQQEINKKLNNFGQDMDLEGNWSDIPLSDIESS STSGSDSSLSDGPPIRLLNIVADE PNQKTVLKNPKKKRLQTRKQRNEQYQKSYLMRELKL

TENAP GRARFVSTLQKQPTFLKSPESPSPSVRRSENPRLNE TQLSGREKGTSLDPPLTSPKNKERIQ SYSQPCVFSLILHEHQAQTSSDTPCQNPES

H - UNI21207 -    
Transcript ENSMUST00000099743
Sequence
AGGCTCCCAGGGTCCTCGCAGAAAACTCCAGCAG - UNI35168 - CTGTTTGGAAATCAGGCAGATATTGCAGCTGGGTACGGTGCTACTAACTCGC

CTACATCATACTATGCGGCAGTAACATGTTCCCGGCGTTGGAAACAGAACTAAAGCCGGAG CGTGTTTGGTGCTTTTGGTTAAGAAGTCAGTGTCATCT

GAATGAATGTCCTGCTTGAGATGGCTTTTCTTTCACAGACTCTTCCTGATCCCTATGAGGACTTTATTCACCATCACCTCCAGTATTATGGATATTTCAA

AG CTCAGAAAAGCAGCCTGCCAAACTCAGGCACTCATCAGCGCGTTTGGAGGAACAGCCCTCGGTACATGTTGAATGGCTCTTTTGGAGAAAGAGATGA

TTTCATCTCGGACAGTTTGGAAAAAGAGATGCTTCTGT GGCCTACCTGTTTATCTTCAACTGGGCATGCTCACATAGACGCTGTAAACAGAG - UNI3

6185 - ACTCACTTCTGCTGAGCTCGCCGCTCCTGAGGACCAGGCAGCTGATTTTTGATGAGCTAGATGAAGCAAGCCCACGGCTTCGAGAACCCCGAG

AACTCTTCTCATGTTTCTCTAGCAGAGGGCCGCTGCAGGCTCCAAGATGGCCAATCGAATGTGAGGTCATCAAGGAAAACATTCATCACATTG - UNI2

2026 - AGTGGGTTCCACATCAACCAGAATATTTCTACCAACCTACAGGAAGCGAGAAGGTGCCAGAGATTGTGGGAGAGGAGCAAGGTACAGTTGTGT

ACCAGCTAGATTCAG TGCCTGCAGAAGGCACCTATTTCACTAGTTCCAGAATAGGAGGCAAACGAGGGACCATCAAGGAACTTGCTGTCACACTGCAAG

GGCCGGACGACAATACTCTATTGTTTGAGTCAAGGTTTGAGAGCGGGAATCTGCAGAAAGCCGTCAGAGT AGGTATCTATGAGTACGAGCTCACCTTGC

GGACTGACCTCTACACGGACAAACACACTCAGTGGTTTTACTTCAGAGTTCAGAACACCAGAAAAGACGCTACCTATCGCTTCACCATCGTCAACTTGCT

GAAACCCAAGAGCCTTTACGCAGTAGGCATGAAGCCTCTCATGTACTCTCAGCTGGATGCCACCATCTACAACATCGGCTGGAGGAGAGAGGGCCGTGAA

ATCAAGTACTACAAGAACAATGTGGACGACGGCCAGCAGCCCTTATACTGCCTCACCTGGACCACTCAGTTTCCTCACGACCAGGACACTTGCTTCTTCG

CACACTTTTACCCATACACTTATACTGACTTGCAATGCTATCTCTTGTCAGTAGCAAACAACCCCATCCAGTCTCAGTTCTGCAAGCTCCGAGCCCTATG

CAGGAGCCTAGCAGGGAACACTGTCTACCTGCTGACCATCACCAACCCATCCAGGACCCCTCAAGAGGCAGCCGCAAAGAAAGCTGTGGTCTTGAGCGCC

CGAGTCCACCCTGGAGAGAGTAACAGCTCCTGGATCATGAACGGCTTTTTGGACTTCATCCTTAGCAACTCTCCCGATGCCCAGCTCCTCAGGGATATCT

TTGTCTTCAAGGTGATTCCCATGTTAAACCCAGATGGCGTGATAGTGGGGAACTATCGGTGTTCGCTGGCTGGAAGGGACTTGAACAGGCATTATAAAAC

CGTTCTTAAGGACTCCTTCCCTTGCATTTGGTACACCAAGAACATGATCAAAAG GCTTCTGGAAGAAAGAGAGGTTCTCTTGTACTGTGATTTCCATGG

GCATAGCCGCAAGAACAACATCTTCCTGTATGGCTGTCACAGCAACAACCGCAAGCACTGGCTCCATGAGCGTGTCTTTCCTTTAATGTTGAGCAAGAAT

GCACCAGACAAG TTCTCTTTCGACAGCTGTAACTTTAAGGTCCAAAAATGCAAAGAAGGAACGGGAAGAGTGGTGATGTGGCGGATGGGCATCATCAAC

AGCTACACCATGGAGTCTACCTTTGGCGGGTCTACCCTGG GTAGTAAAAGAGACACTCACTTTACCATTGAGGACCTGAAGTCCCTAGGGTATCATGTC

TGTGACACTCTTCTGGATTTCTGTGATCCTGACCAAACCAAG TACACACAGTGTCTACAAGAGCTTAAGGAGCTCCTACAACAGGAAATCAACAAAAAG

TTGAATAACTTTGGACAAGATATGGATTTAGAAGGAAACTGGAGTGACATTCCTTTGTCTGACATTGAATCCAG CACGAGTGGCTCGGACAGCTCCCTC

TCCGATGGCCCTCCCATTCGTCTACTGAACATCGTTGCAGATGAG CCAAATCAGAAGACGGTGTTAAAGAATCCAAAAAAGAAGAGACTTCAGACTAGA

AAACAGCGGAATGAGCAGTACCAGAAGAGCTACTTGATGCGGGAGTTAAAGTTAACAGAAAACGCCCCA GGAAGGGCGAGATTTGTCTCTACTCTGCAA

AAGCAGCCTACTTTTTTGAAAAGTCCAGAGAGTCCTAGCCCTTCAGTAAGGAGAAGTGAAAACCCAAGGCTCAATGAG ACACAGTTAAGTGGAAGAGAG

AAGGGCACCTCCCTGGATCCACCACTGACCAGCCCTAAGAATAAAGAAAGAATTCAG AGTAAGAAGCCAGGCTTTACAGCATCATGCTCTCCAAAGAGA

AGCACAAACTCCAGCCTAGGGCCAGCTCCAGATGTGAAGCCAAACTGGTCTAAGACTAGATACTCTGCCACAAGGAAGGACCATGCCACCATGGCCGTGT

ACCCATCCTTGCATATATACACATACCCATAA
Translation
 - UNI35168 -  MNVLLEMAFLSQTLPDPYEDFIHHHLQYYGYFKA AQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLW WPT

CLSSTGHAHIDAVNRD - UNI36185 - DSLLLSSPLLRTRQLIFDELDEASPRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIE - UNI2

2026 - EWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSV VPAEGTYFTSSRIGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRV VG

IYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPLYCLTWTTQFP

HDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSP

DAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKR RLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKHWLHE

RVFPLMLSKNAPDK FSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLG GSKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQTK YTQCLQ

ELKELLQQEINKKLNNFGQDMDLEGNWSDIPLSDIESS STSGSDSSLSDGPPIRLLNIVADE PNQKTVLKNPKKKRLQTRKQRNEQYQKSYLMRELKL

TENAP GRARFVSTLQKQPTFLKSPESPSPSVRRSENPRLNE TQLSGREKGTSLDPPLTSPKNKERIQ SKKPGFTASCSPKRSTNSSLGPAPDVKPNW

SKTRYSATRKDHATMAVYPSLHIYTYP
Transcript ENSMUST00000111483
Sequence
AGGCTCCCAGGGTCCTCGCAGAAAACTCCAGCAG - UNI35168 - CTGTTTGGAAATCAGGCAGATATTGCAGCTGGGTACGGTGCTACTAACTCGC

CTACATCATACTATGCGGCAGTAACATGTTCCCGGCGTTGGAAACAGAACTAAAGCCGGAG CGTGTTTGGTGCTTTTGGTTAAGAAGTCAGTGTCATCT

GAATGAATGTCCTGCTTGAGATGGCTTTTCTTTCACAGACTCTTCCTGATCCCTATGAGGACTTTATTCACCATCACCTCCAGTATTATGGATATTTCAA

AG CTCAGAAAAGCAGCCTGCCAAACTCAGGCACTCATCAGCGCGTTTGGAGGAACAGCCCTCGGTACATGTTGAATGGCTCTTTTGGAGAAAGAGATGA

TTTCATCTCGGACAGTTTGGAAAAAGAGATGCTTCTGT GGCCTACCTGTTTATCTTCAACTGGGCATGCTCACATAGACGCTGTAAACAGAG - UNI3

6185 - ACTCACTTCTGCTGAGCTCGCCGCTCCTGAGGACCAGGCAGCTGATTTTTGATGAGCTAGATGAAGCAAGCCCACGGCTTCGAGAACCCCGAG

AACTCTTCTCATGTTTCTCTAGCAGAGGGCCGCTGCAGGCTCCAAGATGGCCAATCGAATGTGAGGTCATCAAGGAAAACATTCATCACATTG - UNI2

2026 - AGTGGGTTCCACATCAACCAGAATATTTCTACCAACCTACAGGAAGCGAGAAGGTGCCAGAGATTGTGGGAGAGGAGCAAGGTACAGTTGTGT

ACCAGCTAGATTCAG TGCCTGCAGAAGGCACCTATTTCACTAGTTCCAGAATAGGAGGCAAACGAGGGACCATCAAGGAACTTGCTGTCACACTGCAAG

GGCCGGACGACAATACTCTATTGTTTGAGTCAAGGTTTGAGAGCGGGAATCTGCAGAAAGCCGTCAGAGT AGGTATCTATGAGTACGAGCTCACCTTGC

GGACTGACCTCTACACGGACAAACACACTCAGTGGTTTTACTTCAGAGTTCAGAACACCAGAAAAGACGCTACCTATCGCTTCACCATCGTCAACTTGCT

GAAACCCAAGAGCCTTTACGCAGTAGGCATGAAGCCTCTCATGTACTCTCAGCTGGATGCCACCATCTACAACATCGGCTGGAGGAGAGAGGGCCGTGAA

ATCAAGTACTACAAGAACAATGTGGACGACGGCCAGCAGCCCTTATACTGCCTCACCTGGACCACTCAGTTTCCTCACGACCAGGACACTTGCTTCTTCG

CACACTTTTACCCATACACTTATACTGACTTGCAATGCTATCTCTTGTCAGTAGCAAACAACCCCATCCAGTCTCAGTTCTGCAAGCTCCGAGCCCTATG

CAGGAGCCTAGCAGGGAACACTGTCTACCTGCTGACCATCACCAACCCATCCAGGACCCCTCAAGAGGCAGCCGCAAAGAAAGCTGTGGTCTTGAGCGCC

CGAGTCCACCCTGGAGAGAGTAACAGCTCCTGGATCATGAACGGCTTTTTGGACTTCATCCTTAGCAACTCTCCCGATGCCCAGCTCCTCAGGGATATCT

TTGTCTTCAAGGTGATTCCCATGTTAAACCCAGATGGCGTGATAGTGGGGAACTATCGGTGTTCGCTGGCTGGAAGGGACTTGAACAGGCATTATAAAAC

CGTTCTTAAGGACTCCTTCCCTTGCATTTGGTACACCAAGAACATGATCAAAAG GCTTCTGGAAGAAAGAGAGGTTCTCTTGTACTGTGATTTCCATGG

GCATAGCCGCAAGAACAACATCTTCCTGTATGGCTGTCACAGCAACAACCGCAAGCACTGGCTCCATGAGCGTGTCTTTCCTTTAATGTTGAGCAAGAAT

GCACCAGACAAG TTCTCTTTCGACAGCTGTAACTTTAAGGTCCAAAAATGCAAAGAAGGAACGGGAAGAGTGGTGATGTGGCGGATGGGCATCATCAAC

AGCTACACCATGGAGTCTACCTTTGGCGGGTCTACCCTGG GTAGTAAAAGAGACACTCACTTTACCATTGAGGACCTGAAGTCCCTAGGGTATCATGTC

TGTGACACTCTTCTGGATTTCTGTGATCCTGACCAAACCAAG TACACACAGTGTCTACAAGAGCTTAAGGAGCTCCTACAACAGGAAATCAACAAAAAG

TTGAATAACTTTGGACAAGATATGGATTTAGAAGGAAACTGGAGTGACATTCCTTTGTCTGACATTGAATCCAG CACGAGTGGCTCGGACAGCTCCCTC

TCCGATGGCCCTCCCATTCGTCTACTGAACATCGTTGCAGATGAG CCAAATCAGAAGACGGTGTTAAAGAATCCAAAAAAGAAGAGACTTCAGACTAGA

AAACAGCGGAATGAGCAGTACCAGAAGAGCTACTTGATGCGGGAGTTAAAGTTAACAGAAAACGCCCCA ACACAGTTAAGTGGAAGAGAGAAGGGCACC

TCCCTGGATCCACCACTGACCAGCCCTAAGAATAAAGAAAGAATTCAG AGTAAGAAGCCAGGCTTTACAGCATCATGCTCTCCAAAGAGAAGCACAAAC

TCCAGCCTAGGGCCAGCTCCAGATGTGAAGCCAAACTGGTCTAAGACTAGATACTCTGCCACAAGGAAGGACCATGCCACCATGGCCGTGTACCCATCCT

TGCATATATACACATACCCATAA
Translation
 - UNI35168 -  MNVLLEMAFLSQTLPDPYEDFIHHHLQYYGYFKA AQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLW WPT

CLSSTGHAHIDAVNRD - UNI36185 - DSLLLSSPLLRTRQLIFDELDEASPRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIE - UNI2

2026 - EWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSV VPAEGTYFTSSRIGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRV VG

IYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPLYCLTWTTQFP

HDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSP

DAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKR RLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKHWLHE

RVFPLMLSKNAPDK FSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLG GSKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQTK YTQCLQ

ELKELLQQEINKKLNNFGQDMDLEGNWSDIPLSDIESS STSGSDSSLSDGPPIRLLNIVADE PNQKTVLKNPKKKRLQTRKQRNEQYQKSYLMRELKL

TENAP TQLSGREKGTSLDPPLTSPKNKERIQ SKKPGFTASCSPKRSTNSSLGPAPDVKPNWSKTRYSATRKDHATMAVYPSLHIYTYP
Transcript ENSMUST00000111482
Sequence
AGGCTCCCAGGGTCCTCGCAGAAAACTCCAGCAG - UNI35168 - CTGTTTGGAAATCAGGCAGATATTGCAGCTGGGTACGGTGCTACTAACTCGC

CTACATCATACTATGCGGCAGTAACATGTTCCCGGCGTTGGAAACAGAACTAAAGCCGGAG CGTGTTTGGTGCTTTTGGTTAAGAAGTCAGTGTCATCT

GAATGAATGTCCTGCTTGAGATGGCTTTTCTTTCACAGACTCTTCCTGATCCCTATGAGGACTTTATTCACCATCACCTCCAGTATTATGGATATTTCAA

AG CTCAGAAAAGCAGCCTGCCAAACTCAGGCACTCATCAGCGCGTTTGGAGGAACAGCCCTCGGTACATGTTGAATGGCTCTTTTGGAGAAAGAGATGA

TTTCATCTCGGACAGTTTGGAAAAAGAGATGCTTCTGT - UNI36185 - ACTCACTTCTGCTGAGCTCGCCGCTCCTGAGGACCAGGCAGCTGATTT

TTGATGAGCTAGATGAAGCAAGCCCACGGCTTCGAGAACCCCGAGAACTCTTCTCATGTTTCTCTAGCAGAGGGCCGCTGCAGGCTCCAAGATGGCCAAT

CGAATGTGAGGTCATCAAGGAAAACATTCATCACATTG - UNI22026 - AGTGGGTTCCACATCAACCAGAATATTTCTACCAACCTACAGGAAGCG

AGAAGGTGCCAGAGATTGTGGGAGAGGAGCAAGGTACAGTTGTGTACCAGCTAGATTCAG TGCCTGCAGAAGGCACCTATTTCACTAGTTCCAGAATAG

GAGGCAAACGAGGGACCATCAAGGAACTTGCTGTCACACTGCAAGGGCCGGACGACAATACTCTATTGTTTGAGTCAAGGTTTGAGAGCGGGAATCTGCA

GAAAGCCGTCAGAGT AGGTATCTATGAGTACGAGCTCACCTTGCGGACTGACCTCTACACGGACAAACACACTCAGTGGTTTTACTTCAGAGTTCAGAA

CACCAGAAAAGACGCTACCTATCGCTTCACCATCGTCAACTTGCTGAAACCCAAGAGCCTTTACGCAGTAGGCATGAAGCCTCTCATGTACTCTCAGCTG

GATGCCACCATCTACAACATCGGCTGGAGGAGAGAGGGCCGTGAAATCAAGTACTACAAGAACAATGTGGACGACGGCCAGCAGCCCTTATACTGCCTCA

CCTGGACCACTCAGTTTCCTCACGACCAGGACACTTGCTTCTTCGCACACTTTTACCCATACACTTATACTGACTTGCAATGCTATCTCTTGTCAGTAGC

AAACAACCCCATCCAGTCTCAGTTCTGCAAGCTCCGAGCCCTATGCAGGAGCCTAGCAGGGAACACTGTCTACCTGCTGACCATCACCAACCCATCCAGG

ACCCCTCAAGAGGCAGCCGCAAAGAAAGCTGTGGTCTTGAGCGCCCGAGTCCACCCTGGAGAGAGTAACAGCTCCTGGATCATGAACGGCTTTTTGGACT

TCATCCTTAGCAACTCTCCCGATGCCCAGCTCCTCAGGGATATCTTTGTCTTCAAGGTGATTCCCATGTTAAACCCAGATGGCGTGATAGTGGGGAACTA

TCGGTGTTCGCTGGCTGGAAGGGACTTGAACAGGCATTATAAAACCGTTCTTAAGGACTCCTTCCCTTGCATTTGGTACACCAAGAACATGATCAAAAG 

GCTTCTGGAAGAAAGAGAGGTTCTCTTGTACTGTGATTTCCATGGGCATAGCCGCAAGAACAACATCTTCCTGTATGGCTGTCACAGCAACAACCGCAAG

CACTGGCTCCATGAGCGTGTCTTTCCTTTAATGTTGAGCAAGAATGCACCAGACAAG TTCTCTTTCGACAGCTGTAACTTTAAGGTCCAAAAATGCAAA

GAAGGAACGGGAAGAGTGGTGATGTGGCGGATGGGCATCATCAACAGCTACACCATGGAGTCTACCTTTGGCGGGTCTACCCTGG GTAGTAAAAGAGAC

ACTCACTTTACCATTGAGGACCTGAAGTCCCTAGGGTATCATGTCTGTGACACTCTTCTGGATTTCTGTGATCCTGACCAAACCAAG TACACACAGTGT

CTACAAGAGCTTAAGGAGCTCCTACAACAGGAAATCAACAAAAAGTTGAATAACTTTGGACAAGATATGGATTTAGAAGGAAACTGGAGTGACATTCCTT

TGTCTGACATTGAATCCAG CACGAGTGGCTCGGACAGCTCCCTCTCCGATGGCCCTCCCATTCGTCTACTGAACATCGTTGCAGATGAG CCAAATCAG

AAGACGGTGTTAAAGAATCCAAAAAAGAAGAGACTTCAGACTAGAAAACAGCGGAATGAGCAGTACCAGAAGAGCTACTTGATGCGGGAGTTAAAGTTAA

CAGAAAACGCCCCA ACACAGTTAAGTGGAAGAGAGAAGGGCACCTCCCTGGATCCACCACTGACCAGCCCTAAGAATAAAGAAAGAATTCAG AGTAAG

AAGCCAGGCTTTACAGCATCATGCTCTCCAAAGAGAAGCACAAACTCCAGCCTAGGGCCAGCTCCAGATGTGAAGCCAAACTGGTCTAAGACTAGATACT

CTGCCACAAGGAAGGACCATGCCACCATGGCCGTGTACCCATCCTTGCATATATACACATACCCATAA
Translation
 - UNI35168 -  MNVLLEMAFLSQTLPDPYEDFIHHHLQYYGYFKA AQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLY - U

NI36185 - YSLLLSSPLLRTRQLIFDELDEASPRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIE - UNI22026 - EWVPHQPEYFYQP

TGSEKVPEIVGEEQGTVVYQLDSV VPAEGTYFTSSRIGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRV VGIYEYELTLRTDLYTDKHTQW

FYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQ

CYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPD

GVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKR RLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKHWLHERVFPLMLSKNAPDK FSFDS

CNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLG GSKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQTK YTQCLQELKELLQQEINKKLNNFGQD

MDLEGNWSDIPLSDIESS STSGSDSSLSDGPPIRLLNIVADE PNQKTVLKNPKKKRLQTRKQRNEQYQKSYLMRELKLTENAP TQLSGREKGTSLDP

PLTSPKNKERIQ SKKPGFTASCSPKRSTNSSLGPAPDVKPNWSKTRYSATRKDHATMAVYPSLHIYTYP
Transcript ENSMUST00000111481
Sequence
CAGGCAGATATTGCAGCTGGGTACGGTGCTACTAACTCGCCTACATCATACTATGCGGCAGTAACATGTTCCCGGCGTTGGAAACAGAACTAAAGCCGGA

G CGTGTTTGGTGCTTTTGGTTAAGAAGTCAGTGTCATCTGAATGAATGTCCTGCTTGAGATGGCTTTTCTTTCACAGACTCTTCCTGATCCCTATGAGG

ACTTTATTCACCATCACCTCCAGTATTATGGATATTTCAAAG CTCAGAAAAGCAGCCTGCCAAACTCAGGCACTCATCAGCGCGTTTGGAGGAACAGCC

CTCGGTACATGTTGAATGGCTCTTTTGGAGAAAGAGATGATTTCATCTCGGACAGTTTGGAAAAAGAGATGCTTCTGT GGCCTACCTGTTTATCTTCAA

CTGGGCATGCTCACATAGACGCTGTAAACAGAG - UNI36185 - ACTCACTTCTGCTGAGCTCGCCGCTCCTGAGGACCAGGCAGCTGATTTTTGAT

GAGCTAGATGAAGCAAGCCCACGGCTTCGAGAACCCCGAGAACTCTTCTCATGTTTCTCTAGCAGAGGGCCGCTGCAGGCTCCAAGATGGCCAATCGAAT

GTGAGGTCATCAAGGAAAACATTCATCACATTG - UNI22026 - AGTGGGTTCCACATCAACCAGAATATTTCTACCAACCTACAGGAAGCGAGAAG

GTGCCAGAGATTGTGGGAGAGGAGCAAGGTACAGTTGTGTACCAGCTAGATTCAG TGCCTGCAGAAGGCACCTATTTCACTAGTTCCAGAATAGGAGGC

AAACGAGGGACCATCAAGGAACTTGCTGTCACACTGCAAGGGCCGGACGACAATACTCTATTGTTTGAGTCAAGGTTTGAGAGCGGGAATCTGCAGAAAG

CCGTCAGAGT AGGTATCTATGAGTACGAGCTCACCTTGCGGACTGACCTCTACACGGACAAACACACTCAGTGGTTTTACTTCAGAGTTCAGAACACCA

GAAAAGACGCTACCTATCGCTTCACCATCGTCAACTTGCTGAAACCCAAGAGCCTTTACGCAGTAGGCATGAAGCCTCTCATGTACTCTCAGCTGGATGC

CACCATCTACAACATCGGCTGGAGGAGAGAGGGCCGTGAAATCAAGTACTACAAGAACAATGTGGACGACGGCCAGCAGCCCTTATACTGCCTCACCTGG

ACCACTCAGTTTCCTCACGACCAGGACACTTGCTTCTTCGCACACTTTTACCCATACACTTATACTGACTTGCAATGCTATCTCTTGTCAGTAGCAAACA

ACCCCATCCAGTCTCAGTTCTGCAAGCTCCGAGCCCTATGCAGGAGCCTAGCAGGGAACACTGTCTACCTGCTGACCATCACCAACCCATCCAGGACCCC

TCAAGAGGCAGCCGCAAAGAAAGCTGTGGTCTTGAGCGCCCGAGTCCACCCTGGAGAGAGTAACAGCTCCTGGATCATGAACGGCTTTTTGGACTTCATC

CTTAGCAACTCTCCCGATGCCCAGCTCCTCAGGGATATCTTTGTCTTCAAGGTGATTCCCATGTTAAACCCAGATGGCGTGATAGTGGGGAACTATCGGT

GTTCGCTGGCTGGAAGGGACTTGAACAGGCATTATAAAACCGTTCTTAAGGACTCCTTCCCTTGCATTTGGTACACCAAGAACATGATCAAAAG GCTTC

TGGAAGAAAGAGAGGTTCTCTTGTACTGTGATTTCCATGGGCATAGCCGCAAGAACAACATCTTCCTGTATGGCTGTCACAGCAACAACCGCAAGCACTG

GCTCCATGAGCGTGTCTTTCCTTTAATGTTGAGCAAGAATGCACCAGACAAG TTCTCTTTCGACAGCTGTAACTTTAAGGTCCAAAAATGCAAAGAAGG

AACGGGAAGAGTGGTGATGTGGCGGATGGGCATCATCAACAGCTACACCATGGAGTCTACCTTTGGCGGGTCTACCCTGG GTAGTAAAAGAGACACTCA

CTTTACCATTGAGGACCTGAAGTCCCTAGGGTATCATGTCTGTGACACTCTTCTGGATTTCTGTGATCCTGACCAAACCAAG TACACACAGTGTCTACA

AGAGCTTAAGGAGCTCCTACAACAGGAAATCAACAAAAAGTTGAATAACTTTGGACAAGATATGGATTTAGAAGGAAACTGGAGTGACATTCCTTTGTCT

GACATTGAATCCAG CACGAGTGGCTCGGACAGCTCCCTCTCCGATGGCCCTCCCATTCGTCTACTGAACATCGTTGCAGATGAG CCAAATCAGAAGAC

GGTGTTAAAGAATCCAAAAAAGAAGAGACTTCAGACTAGAAAACAGCGGAATGAGCAGTACCAGAAGAGCTACTTGATGCGGGAGTTAAAGTTAACAGAA

AACGCCCCA GGAAGGGCGAGATTTGTCTCTACTCTGCAAAAGCAGCCTACTTTTTTGAAAAGTCCAGAGAGTCCTAGCCCTTCAGTAAGGAGAAGTGAA

AACCCAAGGCTCAATGAG ACACAGTTAAGTGGAAGAGAGAAGGGCACCTCCCTGGATCCACCACTGACCAGCCCTAAGAATAAAGAAAGAATTCAG AG

TAAGAAGCCAGGCTTTACAGCATCATGCTCTCCAAAGAGAAGCACAAACTCCAGCCTAGGGCCAGCTCCAGATGTGAAGCCAAACTGGTCTAAGACTAGA

TACTCTGCCACAAGGAAGGACCATGCCACCATGGCCGTGTACCCATCCTTGCATATATACACATACCCATAAGTGTGCTCTTGCTGCGACACACAGCTGC

TTCCTCCAAAGGTTTTGGGTAGTTTTGTTGGTTTGTTTTGTATGCAATGCTGGGGACCAAACCTCTAGGGCACTGAGCATACTAGGCAAGTGCTTTACCA

TTGAGCTGTGTCTCCAGCCCTCCTGAAAAGTTTATGGGTTATACACATCTTATAAGGGGGAAATCTGTGAATAAAATGGAAACTCTATTTATGGTATACT

GTGTTGTACACTCACCACACACTGACCTTCTCTGGTCTTCCGCTGTGCACTGTCCTTAGATGCATGCCTTGTTACCTCGTGAATTTGTTAGGGATTTTTT

TTTTCCTTAGATGAGATTATATTTTGATGTATAGAAAAGCCTTTATTGAACGCTGAAGCCTGTACACATAAAAAGACAGAACAGTGTATATACTTCATTT

TAACCAATAGATGTTCTCTTTAAAGTTAGATGCAAATCAGTTTTAAAAGATCGAGCTGTTTTAAGTGTGTTTTGGGAATGTGCCATATGAAAAAGTCTTG

TATCGAAGTTTTCAAATGGTGACTGACCAGTCAGACTGTGGTTATATTAGGTTTGCTTAAAGTAAGGTATTCCTACATAGGAAAAAAATAATTACATGTA

TTACTTAGAATTTAATGTTGCTTATATTATGTTCAACAAGGTTGTGTAAGTTTTTAACTCAGTGATTAAAATTCTTTCTCTCTTGTTACT
Translation
 MNVLLEMAFLSQTLPDPYEDFIHHHLQYYGYFKA AQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLW WPTCLSSTGHAHIDAVN

RD - UNI36185 - DSLLLSSPLLRTRQLIFDELDEASPRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIE - UNI22026 - EWVPHQP

EYFYQPTGSEKVPEIVGEEQGTVVYQLDSV VPAEGTYFTSSRIGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRV VGIYEYELTLRTDLYT

DKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPLYCLTWTTQFPHDQDTCFFAHFYPY

TYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVI

PMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKR RLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKHWLHERVFPLMLSKNAPDK

 FSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLG GSKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQTK YTQCLQELKELLQQEINKKL

NNFGQDMDLEGNWSDIPLSDIESS STSGSDSSLSDGPPIRLLNIVADE PNQKTVLKNPKKKRLQTRKQRNEQYQKSYLMRELKLTENAP GRARFVST

LQKQPTFLKSPESPSPSVRRSENPRLNE TQLSGREKGTSLDPPLTSPKNKERIQ SKKPGFTASCSPKRSTNSSLGPAPDVKPNWSKTRYSATRKDHAT

MAVYPSLHIYTYP
Transcript ENSMUST00000037219
Sequence
AGGCTCCCAGGGTCCTCGCAGAAAACTCCAGCAG - UNI35168 - CTGTTTGGAAATCAGGCAGATATTGCAGCTGGGTACGGTGCTACTAACTCGC

CTACATCATACTATGCGGCAGTAACATGTTCCCGGCGTTGGAAACAGAACTAAAGCCGGAG CGTGTTTGGTGCTTTTGGTTAAGAAGTCAGTGTCATCT

GAATGAATGTCCTGCTTGAGATGGCTTTTCTTTCACAGACTCTTCCTGATCCCTATGAGGACTTTATTCACCATCACCTCCAGTATTATGGATATTTCAA

AG CTCAGAAAAGCAGCCTGCCAAACTCAGGCACTCATCAGCGCGTTTGGAGGAACAGCCCTCGGTACATGTTGAATGGCTCTTTTGGAGAAAGAGATGA

TTTCATCTCGGACAGTTTGGAAAAAGAGATGCTTCTGT GGCCTACCTGTTTATCTTCAACTGGGCATGCTCACATAGACGCTGTAAACAGAG - UNI3

6185 - ACTCACTTCTGCTGAGCTCGCCGCTCCTGAGGACCAGGCAGCTGATTTTTGATGAGCTAGATGAAGCAAGCCCACGGCTTCGAGAACCCCGAG

AACTCTTCTCATGTTTCTCTAGCAGAGGGCCGCTGCAGGCTCCAAGATGGCCAATCGAATGTGAGGTCATCAAGGAAAACATTCATCACATTG - UNI2

2026 - AGTGGGTTCCACATCAACCAGAATATTTCTACCAACCTACAGGAAGCGAGAAGGTGCCAGAGATTGTGGGAGAGGAGCAAGGTACAGTTGTGT

ACCAGCTAGATTCAG TGCCTGCAGAAGGCACCTATTTCACTAGTTCCAGAATAGGAGGCAAACGAGGGACCATCAAGGAACTTGCTGTCACACTGCAAG

GGCCGGACGACAATACTCTATTGTTTGAGTCAAGGTTTGAGAGCGGGAATCTGCAGAAAGCCGTCAGAGT AGGTATCTATGAGTACGAGCTCACCTTGC

GGACTGACCTCTACACGGACAAACACACTCAGTGGTTTTACTTCAGAGTTCAGAACACCAGAAAAGACGCTACCTATCGCTTCACCATCGTCAACTTGCT

GAAACCCAAGAGCCTTTACGCAGTAGGCATGAAGCCTCTCATGTACTCTCAGCTGGATGCCACCATCTACAACATCGGCTGGAGGAGAGAGGGCCGTGAA

ATCAAGTACTACAAGAACAATGTGGACGACGGCCAGCAGCCCTTATACTGCCTCACCTGGACCACTCAGTTTCCTCACGACCAGGACACTTGCTTCTTCG

CACACTTTTACCCATACACTTATACTGACTTGCAATGCTATCTCTTGTCAGTAGCAAACAACCCCATCCAGTCTCAGTTCTGCAAGCTCCGAGCCCTATG

CAGGAGCCTAGCAGGGAACACTGTCTACCTGCTGACCATCACCAACCCATCCAGGACCCCTCAAGAGGCAGCCGCAAAGAAAGCTGTGGTCTTGAGCGCC

CGAGTCCACCCTGGAGAGAGTAACAGCTCCTGGATCATGAACGGCTTTTTGGACTTCATCCTTAGCAACTCTCCCGATGCCCAGCTCCTCAGGGATATCT

TTGTCTTCAAGGTGATTCCCATGTTAAACCCAGATGGCGTGATAGTGGGGAACTATCGGTGTTCGCTGGCTGGAAGGGACTTGAACAGGCATTATAAAAC

CGTTCTTAAGGACTCCTTCCCTTGCATTTGGTACACCAAGAACATGATCAAAAG GCTTCTGGAAGAAAGAGAGGTTCTCTTGTACTGTGATTTCCATGG

GCATAGCCGCAAGAACAACATCTTCCTGTATGGCTGTCACAGCAACAACCGCAAGCACTGGCTCCATGAGCGTGTCTTTCCTTTAATGTTGAGCAAGAAT

GCACCAGACAAG TTCTCTTTCGACAGCTGTAACTTTAAGGTCCAAAAATGCAAAGAAGGAACGGGAAGAGTGGTGATGTGGCGGATGGGCATCATCAAC

AGCTACACCATGGAGTCTACCTTTGGCGGGTCTACCCTGG GTAGTAAAAGAGACACTCACTTTACCATTGAGGACCTGAAGTCCCTAGGGTATCATGTC

TGTGACACTCTTCTGGATTTCTGTGATCCTGACCAAACCAAG TACACACAGTGTCTACAAGAGCTTAAGGAGCTCCTACAACAGGAAATCAACAAAAAG

TTGAATAACTTTGGACAAGATATGGATTTAGAAGGAAACTGGAGTGACATTCCTTTGTCTGACATTGAATCCAG CACGAGTGGCTCGGACAGCTCCCTC

TCCGATGGCCCTCCCATTCGTCTACTGAACATCGTTGCAGATGAG CCAAATCAGAAGACGGTGTTAAAGAATCCAAAAAAGAAGAGACTTCAGACTAGA

AAACAGCGGAATGAGCAGTACCAGAAGAGCTACTTGATGCGGGAGTTAAAGTTAACAGAAAACGCCCCA GGAAGGGCGAGATTTGTCTCTACTCTGCAA

AAGCAGCCTACTTTTTTGAAAAGTCCAGAGAGTCCTAGCCCTTCAGTAAGGAGAAGTGAAAACCCAAGGCTCAATGAG ACACAGTTAAGTGGAAGAGAG

AAGGGCACCTCCCTGGATCCACCACTGACCAGCCCTAAGAATAAAGAAAGAATTCAG GGTTTCTCTACATAG
Translation
 - UNI35168 -  MNVLLEMAFLSQTLPDPYEDFIHHHLQYYGYFKA AQKSSLPNSGTHQRVWRNSPRYMLNGSFGERDDFISDSLEKEMLLW WPT

CLSSTGHAHIDAVNRD - UNI36185 - DSLLLSSPLLRTRQLIFDELDEASPRLREPRELFSCFSSRGPLQAPRWPIECEVIKENIHHIE - UNI2

2026 - EWVPHQPEYFYQPTGSEKVPEIVGEEQGTVVYQLDSV VPAEGTYFTSSRIGGKRGTIKELAVTLQGPDDNTLLFESRFESGNLQKAVRV VG

IYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPLYCLTWTTQFP

HDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSP

DAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKR RLLEEREVLLYCDFHGHSRKNNIFLYGCHSNNRKHWLHE

RVFPLMLSKNAPDK FSFDSCNFKVQKCKEGTGRVVMWRMGIINSYTMESTFGGSTLG GSKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQTK YTQCLQ

ELKELLQQEINKKLNNFGQDMDLEGNWSDIPLSDIESS STSGSDSSLSDGPPIRLLNIVADE PNQKTVLKNPKKKRLQTRKQRNEQYQKSYLMRELKL

TENAP GRARFVSTLQKQPTFLKSPESPSPSVRRSENPRLNE TQLSGREKGTSLDPPLTSPKNKERIQ GFST

For any suggestions or comments, please send an email to unitrap@crg.es