Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040818 (A630054L15Rik)
Chromosomal location
Chr 14: 27399064 - 27452880 (+)
Description
family with sequence similarity 116, member A Gene [Source:MGI Symbol;Acc:MGI:2442980]
RefSeq_peptide
NP_666081.1 NP_001127937.1 
UniGene
Mm.260512 Mm.472217 
MGI
MGI:2442980 
Uniprot/SWISSPROT
Q8BH65 
Human Ortholog
ENSG00000174839 (FAM116A)
Omim not available
UniTrap UNI8387
Vector Insertion
Chr 14: 27399349 - 27411718
Public Clones XK417 (baygenomics) IST12430F10 (tigm)
Private Clones OST116715 (lexicon) OST66131 (lexicon) OST36668 (lexicon) OST35338 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13258
Vector Insertion
Chr 14: 27411924 - 27419101
Public Clones (ggtc) CMHD-GT_334B10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32204
Vector Insertion
Chr 14: 27420011 - 27422533
Public Clones IST12709A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20533
Vector Insertion
Chr 14: 27422640 - 27424159
Public Clones IST11375C2 (tigm) IST12111H5 (tigm)
Private Clones OST359496 (lexicon) OST221968 (lexicon) OST214362 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25096
Vector Insertion
Chr 14: 27424240 - 27425361
Public Clones E038A12 (ggtc) IST10562G12 (tigm) IST10450F1 (tigm)
Private Clones OST195297 (lexicon) OST43717 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27889
Vector Insertion
Chr 14: 27425425 - 27426390
Public Clones not available
Private Clones OST45161 (lexicon) OST40212 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20296
Vector Insertion
Chr 14: 27427699 - 27428021
Public Clones IST13044F6 (tigm)
Private Clones OST368010 (lexicon) OST249170 (lexicon) OST241593 (lexicon) OST170435 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037585
Sequence
GCGCGCTCTGCGGCGCGGTCCGCAGCGGAGGCGGCTCAAGCGCCTAGGGGGTGGCGGATGGCTCTGCCGGGCCCGGCGGTCTTTGGGCCCGGTTCCCGCG

GGTCGTTGGACGAGGCCGGGGCTGAGGGGCGCGAGGCGGCGGCCCTTGCGGCGGCGGGAGTCGCGCTGGAGGACGAGGAGGAGGACGATGGCCGCCGGGG

CCTGCTGCGCTGGGACGGCTTCTCGGCCTGGCTACACTGCGTGTGTGTGGTGGGCTTCGACCTGGAGCTGGGCCAGGCGGTGGAG - UNI8387 - GT

GATATATCCTCAGCATTCCAAACTTACTGATAAAGAA AAAACCAATATTTGCTACTTGTCTTTTCCAGACTCAAATTCAG - UNI13258 - GTTGT

CTTGGAGATACCCAGTTTTGTTTTAGATTCCGACAGTCTTCTGGGAGAAGGGTGTCACTACACTGTCTTCTTGATGAATTTGACAAAGATTTACCAGTTT

ACTTAAAG AAAGATCCTGCATATTTTTATGGATATGTGTATTTTCGACAAGTTCGAGATAAAACTCTTAAAAGAGGCTACTTTCAAAAG - UNI3220

4 - TCATTGGTTTTGATCAGCAAACTACCTTATATTCATTTTTTTCACACCGTACTCAAACAGATAGCACCAGAGTATTTTGAAAAAAATGAACCTTAC

TTGGAAGCAG - UNI20533 - CTTGTAATGATGTTGACCGATGGCCTGCCCCAGTGCCAGGGAAAACGCTGCACCTGCCTATCATGGGACTAGTAAT

GAAG - UNI25096 - GTTCGGATTCCCACGTGTCATGACAAGCCTGGGACCACGCAGATGGTGCAGTTAACTCAGCAG - UNI27889 - GCAGA

TACACACACATCTATTATTTTGCCTACTGTTCACGAGGTGGATCTTTTCAG GTGTTTCTGCCCAGTTTTTCTTCACAGTCAGATGCTCTGGGAGTTGGT

GCTCTTGGGAGAGCCCCTGGTGGTCATGGCGCCATCGCCGTCAGAATCTTCAGAAACTGTACTGGCTCTTGTTAA - UNI20296 - CTGTATCTCTC

CATTAAAGTACTTTAGTGATTTTCGGCCTTACTTCACGATTCATGATAGTGAATTCAAAGAATATACTACCCGTACTCAAGCTCC GCCCTCAGTCATCT

TAGGAGTAACCAACCCCTTTTTTGCTAAAACACTACAGCACTGGCCACACATTATTCGAATAGGAGATCTTAAACCTGCAG GTGAAATTCCTAAGCAAG

TTAAAGTGAAAAAGCTGAAGAACCTAAAAACTCTGGATTCTAAACCTG GAGTTTATACTTCTTACAAGCCATATCTAAACAGAGATGAGGAGATCATAA

AACAACTTCAGAAG GGTATACAGCAGAAGCGTCCTTCTGAGGCCCAAAGTGTTATTCTCCGGCGCTATTTTTTGGAACTAACACAAAGTTTCATCATTC

CATTA GAAAGATATGTGGCAAGCTTGATGCCTTTGCAGAAAAGTATTTCTCCTTGGAAG AGTCCACCCCAGTTACGGCAGTTCCTTCCAGAAGAATTT

ATGAAAACACTTGAAAAAACAGGGCCTCAGCTCACCTCTGGAATAAAGGGCGACTGGATTGGACTTTACCG GCAGTTTCTAAAGTCTCCAAATTTTGAT

GGCTGGTTCAAGACCCGGCGGAAAGAAATGACTCAAAAATTGGAGGCACTTCATCTAGAAGCTCTTTGTGAAGAG GACCTCCTTCTCTGGATCCAGAAA

CACACAGAAGTAGAAACAGTGGACCTTGTGTTGAAGCTGAAAAATAAGTTG TTGCAGGCTGGCCGAGAGAGCTTACCTGTGAAGCCTGACACTGTGGAG

AAGTTACGGACACATATAGATGCAATTATCCTGGCCTTACCAGACGACCTGCAAGGCATACTGCTCAAGACCGGCATGACATAACACTTGTCAGGTTTTC

CAGCCAGAAAGGACTGTGAAGCAGGAAGCATACTGACATTCATCTAGACGCACACTGAGCAAGCTCAGGGGCACAGCACGGAAATAAGCAGCAATTGCTA

GATACAGCTGGAAAGGCTGAGCGGACACACAGACATTTGTAGTGCGTTCTGTGGTGGTTCCACAATGCTGAAATACCGAAAGACATTTCCATATTTTTAA

TCACGTTCTAAAGTGCTCTTATGAGAGACCTATGGGGCCATCAGTGTAAGTGACTCCAAACTGCAGTGCCGGCATTGCAGATATTTTTTTAAATTGGTGC

TGCTTTGCCCAATCATGTTGAACTCAGGGGAATAGAAGAATAATGTTCACACTGGCTGTCTTCTTAAGAAGGAAAAACTGAACTTTCCAACTATAGTTAG

ATATAACTGAGGCTTATGTAGTGCCTTCCATTGTCCTATATGTTTCACAGGGTCCAGCTGCTAATTGTAAGGCTTTTTCTTTTTTAATTATGATACATAA

TTTCAAAGGCATTATGTCAAGTAATCACTTGCCCAAAAGTATTTCTTGTTGCCCCTCATGTTTATTGCCTGTTGTTTTAAATTATCATGTAGGTTTTCAT

GTCACAACTCTCTACCATTTTCACAACTTAGGTGTGTCTCCGAGGAAGGAGGCACATGCAGTTCTGGCTATGGAAGAGCTGATTTCTCCTCTCTCTTTTA

CTCACTGGCCTGCATACACTAGGTAGCTTGAATGTCTTTTGAAGACATTCTCACAATGAACATCATAGTTGTTTTTTAAAAGAATATTTTTATGTCAAAG

ATAAGCCATTCATGTAATAATTATTTGAGAGTTTTACATTTACCTTTTAACGTTATTTGTTGGGTGACACTATTTCCCCTAGTGGATGATTTTTAGAAGA

CTTTTCCTGTTGTTGTTTGACATGGGACCTTTTGTGTAAATCAGCATTACACTTTTGTTTGTTTGTTTTCATTTTGTTTGTACTACCTTGCCAAAAGTAG

AATGAGATAGTTTGGTTTCAGATGGGAGTGTTGCAGAAGCCACTGTTCAGATAGGCACACACAAAGCAGCACATGTGTAAATAGCTGTGACTTAAGTACC

TGCCCTTCTGAGCAGCCACACGGTGGCTTCAGAAGCCATCTCTTATTCTTTTGCTGTTATTTTCAAGGGCATTCCTGATCCAAGAAGGTTTCTCTGTGTG

TGTGACTGTGGTCTCATATCTAGGGTGCCCCTTCCTTACTCATGGATACAGTCTCTTGAAGCATACCACTGTCCTAGGAAGAATATGGCATTTGAATGAA

ATCATTTGTCTGGATTGATTGATTGAAAATTTATTTTGTGAAACAATACTGACCTTTCAGAAAAGGGGCAACTACTTTTATATGCTAAAGTACTTCATAA

CTTTCTGGGAAACTTTATTTAGGTAGAAATGGTCATCTTATTATTTTTCAAAAAAATGTATTTTAATAATTTCACAATTTATATACAGTTTGTGACATGA

ATATGAAAGTCATTAGTATTATATCAAGGATTTTTGAAATATACTTCTACAGGATATATCATTTGAAGTTTATTTTGCACACCTAAAGAAAAACATGAAA

TATCAATTAGCATGATAATGCTGTCTTTATGTTTACCACATATAACAGAAACTCAACACATGGTGAAAACCAAATCATATTCACCTACTTTATCTCTTAA

TTTCAAATTATGCATTGGAAACCCAAGGAAGACTGAATGGTTAACTTAAATTTTTATGTCAGTTTTAGAATTTCAGAATTGTCTCTTTCATTGTTTTTGT

TTTTTGTTTTTTTTTTTTTTCGAGACAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGCAACTCACTCTGTAGACCAGGCTGGCCTCCAACTCAGAAATCC

ACCTGCCTCTGCCTCCCGAGTGCTGGGATTAAAGGCGTGTGCTACCACCGCTAGGCTCTTTCATTGTTTTTAAGGAGTTTAGTATTCAAACCCTGCGGTT

TGTTTAATGTGTTATCTCCACCAGCATTAGAAGGAATCAGTGCTTAGGGTGTTCTGTAATGCCTAGTGCCTTCTCTTTACAGTGGAAAAGAGGGTTTGTG

GAGGCATTTATGGTCATTACCCAAAGCTTGAATTAAAGGCCTTGGATTTTAAAAAACTTAGGTAGCTTGTGTTATGTGTCTTCTTTTTTGGTTGGTTTTG

TTTTGGAGACAAGCTTTCGTGTATCCTGGACTGGCTTCACACTCCATGTGTAGCCATGGATGATCTTGAACGTCTGCTTTTCCTGCTTCTACCGCCTCAG

CGTGGAGATTGCTGGCCTGTTCCACCATGCCTAGTTCAGTGCTGAGGCCTGAGCCCAAGGATCCATGCATCTAGGCTAGCACTCTGCCAACTGAGCTACG

TGCCCAGCCCTAACTTGGATTTCTTATATTTGCAATACTTGGAGAAACATACATAATGAAACTTGTACATTATTAAAATATTTTATTTCTAGATAGTTTT

TTTCCAAATGAAATGAAAATCCAAACCTTTTTGTGTGTATTTTATTATAAACAGGTGAAATGATGAGATCCTAGCCAGACGCCGGTGGTGTACACCTTTA

ATCCCAGTGCTCAGAAGGCAGAGACAGTGAAGTGAAATGAAGTGTACTGAGGTTTAAAGCGGTTTAGATGTGGTACTCATTATGGGTATTTGTGTTTGAG

TTTACTTGTTTTTGAGGCAGGGTGTCTTTATGTAGCTCTCAACATTCTGAAACTCACTAATGTCTGGACTGGTTTTGAGCTCACAGAGATTCCATGTCTC

TCCCTTCCTAGTGCTGTGATTAAAGGCAAGTGTCACCATGCCCAGCATAATGGATGGATGGGCACTTGTATGGGTGCACAAAAAATCAACTTTGAGTGCT

GTTCCTCAGGAACCATACTTTGGTGTTTTGGTTTGTTTTTTTGAGACAGAGTTTCTCACTGACCTGGCTAGCTAAAGACTCTAAAAATTCCACACTGATG

CCTACAGGAGAAAAGGTAGGTGGGTAAGACTCTTCACTGAGGCAGAGATACTTTTCTACTACTGAGGATAAGTAATGTTCAGAAGATGTAGCTTTTCAGA

AGATGAGTAATGAAGTAACGTAAGAAAATGAGATTAGTGATACAGTTTACAAAGCCAAAGGGAAAGCAAGGGCAAAAATTCCACTGTTTGTACAGCAATT

AGTAGACCATGTCGCCTGTAGTCTCTGAACAGTGAGTGATATATGTTACATTGAGATTAAGTTTTATTTATTTGCAATACTTGAATTTGATCAGAGAGCC

TCATGCACAGTAGGCAAGTTACCACTAGGCAAAGTAAGAGGATTCAATGGAATACTGTATGTTCAGTGCAATGTCTGTCTTTGTAATCCTTCATAACCAC

TTATCACTGCTAGATATTAGTACTATAGAATATATCCTCTCAAATGTTTGAATGTTAAGAAATATGCAGTTCCCTTTTGGTTTTTGCTAAGTAGCCAAGT

GTAGTCTTGAACTCACAATCCTCCTATCCCAGACTCCAGAGTAGTACAACTTCAGACATGTACCACTGTCCCCAGTTATTTTTTAAATGAGCTTGAAGTG

TAGAAATACCTACAGCATTAAACCCAAAAGGACTATATATACAACATTTGTAAGCAAAGGGATGTCATTAAGAATGATTGGTTAGCCGGGCGTGGTGTCG

CATGCCTTTAATCCTAGCACTCGGGAAGCAGAGGCAGGCGGATTTCTGAGTTGGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTAT

ACAGAGAAACCCTGTCTCG
Translation
MALPGPAVFGPGSRGSLDEAGAEGREAAALAAAGVALEDEEEDDGRRGLLRWDGFSAWLHCVCVVGFDLELGQAVE - UNI8387 - VIYPQHSKLTD

KE KTNICYLSFPDSNSG - UNI13258 - GCLGDTQFCFRFRQSSGRRVSLHCLLDEFDKDLPVYLK KDPAYFYGYVYFRQVRDKTLKRGYFQK -

 UNI32204 - SLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAA - UNI20533 - ACNDVDRWPAPVPGKTLHLPIMGLVMK - UNI25096

 - VRIPTCHDKPGTTQMVQLTQQ - UNI27889 - ADTHTSIILPTVHEVDLFR RCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVN

 - UNI20296 - NCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAP PPSVILGVTNPFFAKTLQHWPHIIRIGDLKPAG GEIPKQVKVKKLKNLKTL

DSKPG GVYTSYKPYLNRDEEIIKQLQK GIQQKRPSEAQSVILRRYFLELTQSFIIPL ERYVASLMPLQKSISPWK SPPQLRQFLPEEFMKTLEKTG

PQLTSGIKGDWIGLYR RQFLKSPNFDGWFKTRRKEMTQKLEALHLEALCEE DLLLWIQKHTEVETVDLVLKLKNKL LQAGRESLPVKPDTVEKLRTH

IDAIILALPDDLQGILLKTGMT

For any suggestions or comments, please send an email to unitrap@crg.es