Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040822 (1700123O20Rik)
Chromosomal location
Chr 14: 55305879 - 55309569 (+)
Description
RIKEN cDNA 1700123O20 gene Gene [Source:MGI Symbol;Acc:MGI:1920893]
RefSeq_dna
NM_021437 
RefSeq_peptide
NP_067412.1 
MGI
MGI:1920893 
Uniprot/SWISSPROT
Q9JJ93 
Uniprot/SPTREMBL
Q3TC60 
Human Ortholog
ENSG00000179933 (C14orf119)
Omim not available
UniTrap UNI18555
Vector Insertion
Chr 14: 55305958 - 55308640
Public Clones not available
Private Clones OST420806 (lexicon) OST262789 (lexicon) OST205292 (lexicon) OST141068 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038539
Sequence
ATGGAAGAGGCTCGGAGAGTTGGAGCAGGAGCTGAAGGACTCTTGTGATCTCTGGGCGTCTTCCAAGGGGAAAAGGAAG - UNI18555 - GATGTCA

CTGGAATCGTCTTCCACATCGGTGCCACCCTGCTTCCCTTCTGTGTTACCTTCAGTGCCTGATGACATTGCCAGCTCTTCCCCTCCTCCAATGTCTTACA

TCACTTCCCAGGAGATGAAGTGTATTCTTTACTGGTTTGCCAGTTGGTCAGGTCCCCAGCGGGAACGTTTTCTACAGGACCTGGTCGCTAAGGCAGTGCC

GGGAAAGCTACAGCCACTGCTGGATGCTCTGGAGCAGCTCAGTATGTCTGCAGCAAATCGACCACCATGTATCTTTGAGTGTCAGCTACGTCTTTGGGAT

CAGTGGTTTCGAGGTTGGGCTGAGCAGGAGCGCAATGAATTTGTCAGGCAGCTGGAGGTCAGTGAGCCAGATTTCGTGGCGAAGTTTTACCAAGCAGTGG

CTGCTACTGCTGGTAAGGACTGACAGGCATTCAAATCAAGAAGAGAATGACATGTGATCACACCATGACTGTAGTGATGACTCAGTGCAAGTATGTCACT

TAAAGATTCACCTGAACTGCCAGGGTAGTGGTCCGCCTTTTATTCCAGCACCCAGGAGGCACCCTGGTCTACATAGCAAGTTCCAGGCCAGCCAGCACTA

CAAAGCGAGACCCTGCCTTAAAAAAATTTTTTTTTGCATGAACTTCCTGTTGAAGGCTAGCACTGTTTTTACCCTAGTGGTATGTCACCTGGACTCTCTC

CCATTTTAGCAAATCTGATTATTTACAGGAGATGTCTAAGTCTCAAGAATTTAATGACTGCTTTTGTTACTATAACTAAAGGGACCAGTATCTTGTAACT

CAAGCCTACAGTGGGCCCAGATGGGGCTGTTTTGCCACATTTACTCAACTCTAGCATAATTATGTGATTTCCCCACTGCTGGATTTCCCAGCGATGATTT

AATAAATTTAAGGAAAATTGAG
Translation
 - UNI18555 - MSLESSSTSVPPCFPSVLPSVPDDIASSSPPPMSYITSQEMKCILYWFASWSGPQRERFLQDLVAKAVPGKLQPLLDALEQLSMSA

ANRPPCIFECQLRLWDQWFRGWAEQERNEFVRQLEVSEPDFVAKFYQAVAATAGKD

For any suggestions or comments, please send an email to unitrap@crg.es