Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040829 (Zmynd15)
Chromosomal location
Chr 11: 70272935 - 70279704 (+)
Description
zinc finger, MYND-type containing 15 Gene [Source:MGI (curated);Acc:Zmynd15-005]
Human Ortholog
not available
Omim not available
UniTrap UNI37877
Vector Insertion
Chr 11: 70273583 - 70274394
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039093
Sequence
GTCCGGAACCGACCGTCTGGTCGGTACCGGGGAGCCCGCTTTGCGCCCAGCTCCCAGTCGGGGGACACACACACCCCTGCCCCGAAGGCGGAGCTCCAGT

CTCCGGCCGGCCAGCCGTAGGGTCAGCCAAGACTATCCGACAAAACCGAAAGAAAATTTGGGCTGTAGAACCAGAGGAATCCGAGTGAGCAAGCTGTGGT

TCCCGAAGAATGACTCGGTTGGGTTCGGGGATTTCAGCCCTCTTGAGAAGTCATCTGTCTGTCTGCTGGTTTGTAAAGTGGGTGACCCTCTAGATCCTTC

CTCTGGCTCCAAGATGCTTTCACTTCCCTGGACCGCTGGGTCTCAGTAGGATCCAGTCACATGGCCAAGGTGAAGCAGTCAAACAAGTCACCAGACCTGT

AGGAATGCCCACGCCCTGGCCTGATACTGCCTGACGTCACGACGGTCCTCCAGCACGAG - UNI37877 - CCCTGAGTATCTAAAGACATGGAGTTT

GTGTCTGGATACCGAGACGAGTTCCTCGATTTTGCTGCTCTTCTCTTTGGCTGGTTCCGCAAGTTTGTGGCAGAGAGGGGGACCATGGGGACCAGCCTTG

AGGGCCGATGGCGTCAACTGGAGTCACAGATAAGGAGGCTGCCTCAGGATCCTGCCCTTTGGGTGCTCCATGTCTTACCAAACCGCAGTGTGGGCATCAG

CCTGGGGCAAGGTGCCGAGCCAGGTCCTGGGCCAGGCCTAGGGGCTTCCCGGCTCCTGGGAGATGAGCCTCCACTTCACCTGAGAGACCTGAGTCCTTAT

GTCAGTTTTGTCAGCCTAGAGGATGGGGAAGAAGGGGAGGAGGAGGAGGAAGATGAGGAGCATGGAGAGAGGCCAGGCATGGAGAAGGTGGAACCACAGG

AGGGTGGGGAGCCAGCCCCTCCAAGCAAGAGATTCCCCCAAGAAGCAAAGCCTGCTCCAGAGTCAGAGGTGACCCAGCAGGAGGCAAGCCGAGAAGAAGG

CAGCAGAGAGGAGCGACCAGAGGATGAGAGGGCTCCTGAAAAGAGGAAAGGACAGAAGAATG CAGAGGCTGCCCCCCTGCACCTTTCCTGCCTTTTGCT

GGTGACGGACGAGCATGGCACCATCTTGGGCATTGATCTGCTAATGGATGGAGCCCAGGGGAGTGTAGGCCAGAACCCAGGCACTGAGAATCTGGCTCCT

CGGGCCTATGCTCTCCTCTGTCATAGCATGGCCTGCCCTATGGGCTCTGGGGACCCCCGCAAGCCCCGACAGCTTACCGTAGGAGACGCCCATCTCCATC

G AGAGCTAGAGAGCCTGGTCCCAAGGCTGGGTGTGAAGTTGGCAAAAACCCCAATGCGCACGTGGGGTCCTCGGCCAGGTTTTACTTTTGCCTCCCTTC

GGGCTCGAACCTGCCATGTTTGTCACAAGCACAGCTTTGAGGTGAAGTTGACACCCTG CCCCCAGTGCAGTGCAGTCTTGTACTGTGGAGAGGCTTGTC

TCCAGGCTGATTGGCGGCGATGCCCAGATGACGTGAGCCACCGATTCTGGTGCCCAAGGCTCTCAGCGTTCATGGAGCGGGTCGGAGAACTGGCAAGTTT

GCCTTTCACCTATACTGCAG AAGTTACCAGTGAAACCTTTAACAAGGAAGCTTTCCTGGCCTCCCGAGGCCTCACTCGTGGTTATTGGACCCAGCTCAG

CATGCTGATTCCAGGGCCGGGTGCCCCCAGGTACCCCTGGGGCAGCACATCATCCCTCAGCTGCCTTCTCAACG GTGATCCTTACCAGCTTCTGCAGGG

AGACGGGCCTGCCTTGATGCCTCCGGTGCCCCTCGAGCCACCCAGGAGCCTCTTTG GTTCATGGCAGGATTACTACACGTGGCGGGGCCTCAGCCTGGA

CTCCCCCATGGCTGTGCTTCTCACCTACCCACTGACGGTGTACTATGTCATCACCCACCTGGTACCCCAGTCCT TCCCTGAGCTCAACATCCAGAACAA

GCAATCCCTGAAGATCCACGTGGTGGAGGCTGGCAAGGAATTCGATCTCGTCATGGTGTTTTGG GAGCTCTTGGTCCTTCTCCCCCATGTGGCCCTGGA

GCTACAGTTTGTGGGTGACAGCCTGCCACCTGAGAGTGACCAGCAGCATTTTACTATGCAGAGG GATGGACCTGAGGTGTCTCTGCGTCCTGGTTCTGG

AGTATCAGCACGGTTCAACTCTGGGACTAAGGAGAAGGGAGGTCGAAGGGACCTGCAAATCAGGGTGTCTGCCAGGCCCTATCACCTGCTCCAGGGACCC

AAGCCTGACCTGGTTATTG GATTTAACTCCGGCTTTGGTCTCAAAGATACATGGCTGAGCTCTCTACCCCGGTTACAG TCTCTCCGAGTGCCAGCATT

CTTCACTGAGAGCAGTGAGTACGGCTGTGTGATGGACGATCAGACTATGGCGGTGGCCACCGGAGGGGGCACCAGCTCGCCACAGCCCAACCCCTTCCGC

TCCCCATTCCGCCTTAGAGCAGCTGACAACTGTATGCCCTG GTACTGCAACGCCTTCATCTTCCATTTGGTCTACAAGCCTCCCCAAGGCGGCACAGTC

CGCTCGGCTCCCGGCCCTGCACCTAGACCCCCAACTCCCGCTGCACCTCCTGTCCCGGCTCGAAGGCGCCGAGGAGAAAAGAAAGCTGCACGCGGGCCCC

GCCGGCGCAGATGAGAGCGGACTTGGCAGCCGTCCATTCCCAAGCATGCGCCCTAAAGGAAAACATTCCAAGGCCCAGGGAAGACTGATTGTCGGAACAC

AAAAGGTTAAATAAAATTACTTGTTTG
Translation
 - UNI37877 - MEFVSGYRDEFLDFAALLFGWFRKFVAERGTMGTSLEGRWRQLESQIRRLPQDPALWVLHVLPNRSVGISLGQGAEPGPGPGLGAS

RLLGDEPPLHLRDLSPYVSFVSLEDGEEGEEEEEDEEHGERPGMEKVEPQEGGEPAPPSKRFPQEAKPAPESEVTQQEASREEGSREERPEDERAPEKRK

GQKNA AEAAPLHLSCLLLVTDEHGTILGIDLLMDGAQGSVGQNPGTENLAPRAYALLCHSMACPMGSGDPRKPRQLTVGDAHLHR RELESLVPRLGVK

LAKTPMRTWGPRPGFTFASLRARTCHVCHKHSFEVKLTPC CPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLSAFMERVGELASLPFTYTAE EVT

SETFNKEAFLASRGLTRGYWTQLSMLIPGPGAPRYPWGSTSSLSCLLNG GDPYQLLQGDGPALMPPVPLEPPRSLFG GSWQDYYTWRGLSLDSPMAVL

LTYPLTVYYVITHLVPQSF FPELNIQNKQSLKIHVVEAGKEFDLVMVFW ELLVLLPHVALELQFVGDSLPPESDQQHFTMQR DGPEVSLRPGSGVSA

RFNSGTKEKGGRRDLQIRVSARPYHLLQGPKPDLVIG GFNSGFGLKDTWLSSLPRLQ SLRVPAFFTESSEYGCVMDDQTMAVATGGGTSSPQPNPFRS

PFRLRAADNCMPW WYCNAFIFHLVYKPPQGGTVRSAPGPAPRPPTPAAPPVPARRRRGEKKAARGPRRRR
Transcript ENSMUST00000108564
Sequence
GTCCGGAACCGACCGTCTGGTCGGTACCGGGGAGCCCGCTTTGCGCCCAGCTCCCAGTCGGGGGACACACACACCCCTGCCCCGAAGGCGGAGCTCCAGT

CTCCGGCCGGCCAGCCGTAGGGTCAGCCAAGACTATCCGACAAAACCGAAAGAAAATTTGGGCTGTAGAACCAGAGGAATCCGAGTGAGCAAGCTGTGGT

TCCCGAAGAATGACTCGGTTGGGTTCGGGGATTTCAGCCCTCTTGAGAAGTCATCTGTCTGTCTGCTGGTTTGTAAAGTGGGTGACCCTCTAGATCCTTC

CTCTGGCTCCAAGATGCTTTCACTTCCCTGGACCGCTGGGTCTCAGTAGGATCCAGTCACATGGCCAAGGTGAAGCAGTCAAACAAGTCACCAGACCTGT

AGGAATGCCCACGCCCTGGCCTGATACTGCCTGACGTCACGACGGTCCTCCAGCACGAG - UNI37877 - CCCTGAGTATCTAAAGACATGGAGTTT

GTGTCTGGATACCGAGACGAGTTCCTCGATTTTGCTGCTCTTCTCTTTGGCTGGTTCCGCAAGTTTGTGGCAGAGAGGGGGACCATGGGGACCAGCCTTG

AGGGCCGATGGCGTCAACTGGAGTCACAGATAAGGAGGCTGCCTCAGGATCCTGCCCTTTGGGTGCTCCATGTCTTACCAAACCGCAGTGTGGGCATCAG

CCTGGGGCAAGGTGCCGAGCCAGGTCCTGGGCCAGGCCTAGGGGCTTCCCGGCTCCTGGGAGATGAGCCTCCACTTCACCTGAGAGACCTGAGTCCTTAT

GTCAGTTTTGTCAGCCTAGAGGATGGGGAAGAAGGGGAGGAGGAGGAGGAAGATGAGGAGCATGGAGAGAGGCCAGGCATGGAGAAGGTGGAACCACAGG

AGGGTGGGGAGCCAGCCCCTCCAAGCAAGAGATTCCCCCAAGAAGCAAAGCCTGCTCCAGAGTCAGAGGTGACCCAGCAGGAGGCAAGCCGAGAAGAAGG

CAGCAGAGAGGAGCGACCAGAGGATGAGAGGGCTCCTGAAAAGAGGAAAGGACAGAAGAATG AGGCTGCCCCCCTGCACCTTTCCTGCCTTTTGCTGGT

GACGGACGAGCATGGCACCATCTTGGGCATTGATCTGCTAATGGATGGAGCCCAGGGGAGTGTAGGCCAGAACCCAGGCACTGAGAATCTGGCTCCTCGG

GCCTATGCTCTCCTCTGTCATAGCATGGCCTGCCCTATGGGCTCTGGGGACCCCCGCAAGCCCCGACAGCTTACCGTAGGAGACGCCCATCTCCATCG A

GAGCTAGAGAGCCTGGTCCCAAGGCTGGGTGTGAAGTTGGCAAAAACCCCAATGCGCACGTGGGGTCCTCGGCCAGGTTTTACTTTTGCCTCCCTTCGGG

CTCGAACCTGCCATGTTTGTCACAAGCACAGCTTTGAGGTGAAGTTGACACCCTG CCCCCAGTGCAGTGCAGTCTTGTACTGTGGAGAGGCTTGTCTCC

AGGCTGATTGGCGGCGATGCCCAGATGACGTGAGCCACCGATTCTGGTGCCCAAGGCTCTCAGCGTTCATGGAGCGGGTCGGAGAACTGGCAAGTTTGCC

TTTCACCTATACTGCAG AAGTTACCAGTGAAACCTTTAACAAGGAAGCTTTCCTGGCCTCCCGAGGCCTCACTCGTGGTTATTGGACCCAGCTCAGCAT

GCTGATTCCAGGGCCGGGTGCCCCCAGGTACCCCTGGGGCAGCACATCATCCCTCAGCTGCCTTCTCAACG GTGATCCTTACCAGCTTCTGCAGGGAGA

CGGGCCTGCCTTGATGCCTCCGGTGCCCCTCGAGCCACCCAGGAGCCTCTTTG TCCCTGAGCTCAACATCCAGAACAAGCAATCCCTGAAGATCCACGT

GGTGGAGGCTGGCAAGGAATTCGATCTCGTCATGGTGTTTTGG GAGCTCTTGGTCCTTCTCCCCCATGTGGCCCTGGAGCTACAGTTTGTGGGTGACAG

CCTGCCACCTGAGAGTGACCAGCAGCATTTTACTATGCAGAGG GATGGACCTGAGGTGTCTCTGCGTCCTGGTTCTGGAGTATCAGCACGGTTCAACTC

TGGGACTAAGGAGAAGGGAGGTCGAAGGGACCTGCAAATCAGGGTGTCTGCCAGGCCCTATCACCTGCTCCAGGGACCCAAGCCTGACCTGGTTATTG G

ATTTAACTCCGGCTTTGGTCTCAAAGATACATGGCTGAGCTCTCTACCCCGGTTACAG TCTCTCCGAGTGCCAGCATTCTTCACTGAGAGCAGTGAGTA

CGGCTGTGTGATGGACGATCAGACTATGGCGGTGGCCACCGGAGGGGGCACCAGCTCGCCACAGCCCAACCCCTTCCGCTCCCCATTCCGCCTTAGAGCA

GCTGACAACTGTATGCCCTG GTACTGCAACGCCTTCATCTTCCATTTGGTCTACAAGCCTCCCCAAGGCGGCACAGTCCGCTCGGCTCCCGGCCCTGCA

CCTAGACCCCCAACTCCCGCTGCACCTCCTGTCCCGGCTCGAAGGCGCCGAGGAGAAAAGAAAGCTGCACGCGGGCCCCGCCGGCGCAGATGAGAGCGGA

CTTGGCAGCCGTCCATTCCCAAGCATGCGCCCTAAAGGAAAACATTCCAAGGCCCAGGGAAGACTGATTGTCGGAACACAAAAGGTTAAATAAAATTACT

TGTTTG
Translation
 - UNI37877 - MEFVSGYRDEFLDFAALLFGWFRKFVAERGTMGTSLEGRWRQLESQIRRLPQDPALWVLHVLPNRSVGISLGQGAEPGPGPGLGAS

RLLGDEPPLHLRDLSPYVSFVSLEDGEEGEEEEEDEEHGERPGMEKVEPQEGGEPAPPSKRFPQEAKPAPESEVTQQEASREEGSREERPEDERAPEKRK

GQKNE EAAPLHLSCLLLVTDEHGTILGIDLLMDGAQGSVGQNPGTENLAPRAYALLCHSMACPMGSGDPRKPRQLTVGDAHLHR RELESLVPRLGVKL

AKTPMRTWGPRPGFTFASLRARTCHVCHKHSFEVKLTPC CPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLSAFMERVGELASLPFTYTAE EVTS

ETFNKEAFLASRGLTRGYWTQLSMLIPGPGAPRYPWGSTSSLSCLLNG GDPYQLLQGDGPALMPPVPLEPPRSLFV VPELNIQNKQSLKIHVVEAGKE

FDLVMVFW ELLVLLPHVALELQFVGDSLPPESDQQHFTMQR DGPEVSLRPGSGVSARFNSGTKEKGGRRDLQIRVSARPYHLLQGPKPDLVIG GFNS

GFGLKDTWLSSLPRLQ SLRVPAFFTESSEYGCVMDDQTMAVATGGGTSSPQPNPFRSPFRLRAADNCMPW WYCNAFIFHLVYKPPQGGTVRSAPGPAP

RPPTPAAPPVPARRRRGEKKAARGPRRRR
Transcript ENSMUST00000092958
Sequence
AAGACATGGAGTTTGTGTCTGGATACCGAGACGAGTTCCTCGATTTTGCTGCTCTTCTCTTTGGCTGGTTCCGCAAGTTTGTGGCAGAGAGGGGGACCAT

GGGGACCAGCCTTGAGGGCCGATGGCGTCAACTGGAGTCACAGATAAGGAGGCTGCCTCAGGATCCTGCCCTTTGGGTGCTCCATGTCTTACCAAACCGC

AGTGTGGGCATCAGCCTGGGGCAAGGTGCCGAGCCAGGTCCTGGGCCAGGCCTAGGGGCTTCCCGGCTCCTGGGAGATGAGCCTCCACTTCACCTGAGAG

ACCTGAGTCCTTATGTCAGTTTTGTCAGCCTAGAGGATGGGGAAGAAGGGGAGGAGGAGGAGGAAGATGAGGAGCATGGAGAGAGGCCAGGCATGGAGAA

GGTGGAACCACAGGAGGGTGGGGAGCCAGCCCCTCCAAGCAAGAGATTCCCCCAAGAAGCAAAGCCTGCTCCAGAGTCAGAGGTGACCCAGCAGGAGGCA

AGCCGAGAAGAAGGCAGCAGAGAGGAGCGACCAGAGGATGAGAGGGCTCCTGAAAAGAGGAAAGGACAGAAGAATG AGGCTGCCCCCCTGCACCTTTCC

TGCCTTTTGCTGGTGACGGACGAGCATGGCACCATCTTGGGCATTGATCTGCTAATGGATGGAGCCCAGGGGAGTGTAGGCCAGAACCCAGGCACTGAGA

ATCTGGCTCCTCGGGCCTATGCTCTCCTCTGTCATAGCATGGCCTGCCCTATGGGCTCTGGGGACCCCCGCAAGCCCCGACAGCTTACCGTAGGAGACGC

CCATCTCCATCG AGAGCTAGAGAGCCTGGTCCCAAGGCTGGGTGTGAAGTTGGCAAAAACCCCAATGCGCACGTGGGGTCCTCGGCCAGGTTTTACTTT

TGCCTCCCTTCGGGCTCGAACCTGCCATGTTTGTCACAAGCACAGCTTTGAGGTGAAGTTGACACCCTG CCCCCAGTGCAGTGCAGTCTTGTACTGTGG

AGAGGCTTGTCTCCAGGCTGATTGGCGGCGATGCCCAGATGACGTGAGCCACCGATTCTGGTGCCCAAGGCTCTCAGCGTTCATGGAGCGGGTCGGAGAA

CTGGCAAGTTTGCCTTTCACCTATACTGCAG AAGTTACCAGTGAAACCTTTAACAAGGAAGCTTTCCTGGCCTCCCGAGGCCTCACTCGTGGTTATTGG

ACCCAGCTCAGCATGCTGATTCCAGGGCCGGGTGCCCCCAGGTACCCCTGGGGCAGCACATCATCCCTCAGCTGCCTTCTCAACG GTGATCCTTACCAG

CTTCTGCAGGGAGACGGGCCTGCCTTGATGCCTCCGGTGCCCCTCGAGCCACCCAGGAGCCTCTTTG TCCCTGAGCTCAACATCCAGAACAAGCAATCC

CTGAAGATCCACGTGGTGGAGGCTGGCAAGGAATTCGATCTCGTCATGGTGTTTTGG GAGCTCTTGGTCCTTCTCCCCCATGTGGCCCTGGAGCTACAG

TTTGTGGGTGACAGCCTGCCACCTGAGAGTGACCAGCAGCATTTTACTATGCAGAGG GATGGACCTGAGGTGTCTCTGCGTCCTGGTTCTGGAGTATCA

GCACGGTTCAACTCTGGGACTAAGGAGAAGGGAGGTCGAAGGGACCTGCAAATCAGGGTGTCTGCCAGGCCCTATCACCTGCTCCAGGGACCCAAGCCTG

ACCTGGTTATTG GATTTAACTCCGGCTTTGGTCTCAAAGATACATGGCTGAGCTCTCTACCCCGGTTACAG TCTCTCCGAGTGCCAGCATTCTTCACT

GAGAGCAGTGAGTACGGCTGTGTGATGGACGATCAGACTATGGCGGTGGCCACCGGAGGGGGCACCAGCTCGCCACAGCCCAACCCCTTCCGCTCCCCAT

TCCGCCTTAGAGCAGCTGACAACTGTATGCCCTG GTACTGCAACGCCTTCATCTTCCATTTGGTCTACAAGCCTCCCCAAGGCGGCACAGTCCGCTCGG

CTCCCGGCCCTGCACCTAGACCCCCAACTCCCGCTGCACCTCCTGTCCCGGCTCGAAGGCGCCGAGGAGAAAAGAAAGCTGCACGCGGGCCCCGCCGGCG

CAGATGAGAGC
Translation
MEFVSGYRDEFLDFAALLFGWFRKFVAERGTMGTSLEGRWRQLESQIRRLPQDPALWVLHVLPNRSVGISLGQGAEPGPGPGLGASRLLGDEPPLHLRDL

SPYVSFVSLEDGEEGEEEEEDEEHGERPGMEKVEPQEGGEPAPPSKRFPQEAKPAPESEVTQQEASREEGSREERPEDERAPEKRKGQKNE EAAPLHLS

CLLLVTDEHGTILGIDLLMDGAQGSVGQNPGTENLAPRAYALLCHSMACPMGSGDPRKPRQLTVGDAHLHR RELESLVPRLGVKLAKTPMRTWGPRPGF

TFASLRARTCHVCHKHSFEVKLTPC CPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLSAFMERVGELASLPFTYTAE EVTSETFNKEAFLASRGL

TRGYWTQLSMLIPGPGAPRYPWGSTSSLSCLLNG GDPYQLLQGDGPALMPPVPLEPPRSLFV VPELNIQNKQSLKIHVVEAGKEFDLVMVFW ELLVL

LPHVALELQFVGDSLPPESDQQHFTMQR DGPEVSLRPGSGVSARFNSGTKEKGGRRDLQIRVSARPYHLLQGPKPDLVIG GFNSGFGLKDTWLSSLPR

LQ SLRVPAFFTESSEYGCVMDDQTMAVATGGGTSSPQPNPFRSPFRLRAADNCMPW WYCNAFIFHLVYKPPQGGTVRSAPGPAPRPPTPAAPPVPARR

RRGEKKAARGPRRRR
Transcript ENSMUST00000108563
Sequence
AAAGCCCCGCCTCATCTCCGGCTTCTGCGGAGCTTGTTGGGACGAGGTCACCTAGCCGACATCCAGCCAATTCTCTAAAGCTTTCTCTTCTTCACCCTGA

CTGATGTTTTGCGAAGGCGCTGATCCGTGCCAAGCTCAGGAGGGGAGGGGGCGCGAGGTGGTGGCGCCTTCTGTCCCCCGGCGCGCGCTGTCCGGAACCG

ACCGTCTGGTCGGTACCGGGGAGCCCGCTTTGCGCCCAGCTCCCAGTCGGGGGACACACACACCCCTGCCCCGAAGGCGGAGCTCCAGTCTCCGGCCGGC

CAGCCGTAGGGTCAGCCAAGACTATCCGACAAAACCGAAAGAAAATTTGGGCTGTAGAACCAGAGGAATCCGAGTGAGCAAGCTGTGGTTCCCGAAGAAT

GACTCGGTTGGGTTCGGGGATTTCAGCCCTCTTGAGAAGTCATCTGTCTGTCTGCTGGTTTGTAAAGTGGGTGACCCTCTAGATCCTTCCTCTGGCTCCA

AGATGCTTTCACTTCCCTGGACCGCTGGGTCTCAGTAGGATCCAGTCACATGGCCAAGGTGAAGCAGTCAAACAAGTCACCAGACCTGTAGGAATGCCCA

CGCCCTGGCCTGATACTGCCTGACGTCACGACGGTCCTCCAGCACGAG - UNI37877 - CCTAGAGGATGGGGAAGAAGGGGAGGAGGAGGAGGAAG

ATGAGGAGCATGGAGAGAGGCCAGGCATGGAGAAGGTGGAACCACAGGAGGGTGGGGAGCCAGCCCCTCCAAGCAAGAGATTCCCCCAAGAAGCAAAGCC

TGCTCCAGAGTCAGAGGTGACCCAGCAGGAGGCAAGCCGAGAAGAAGGCAGCAGAGAGGAGCGACCAGAGGATGAGAGGGCTCCTGAAAAGAGGAAAGGA

CAGAAGAATG CAGAGGCTGCCCCCCTGCACCTTTCCTGCCTTTTGCTGGTGACGGACGAGCATGGCACCATCTTGGGCATTGATCTGCTAATGGATGGA

GCCCAGGGGAGTGTAGGCCAGAACCCAGGCACTGAGAATCTGGCTCCTCGGGCCTATGCTCTCCTCTGTCATAGCATGGCCTGCCCTATGGGCTCTGGGG

ACCCCCGCAAGCCCCGACAGCTTACCGTAGGAGACGCCCATCTCCATCG AGAGCTAGAGAGCCTGGTCCCAAGGCTGGGTGTGAAGTTGGCAAAAACCC

CAATGCGCACGTGGGGTCCTCGGCCAGGTTTTACTTTTGCCTCCCTTCGGGCTCGAACCTGCCATGTTTGTCACAAGCACAGCTTTGAGGTGAAGTTGAC

ACCCTG CCCCCAGTGCAGTGCAGTCTTGTACTGTGGAGAGGCTTGTCTCCAGGCTGATTGGCGGCGATGCCCAGATGACGTGAGCCACCGATTCTGGTG

CCCAAGGCTCTCAGCGTTCATGGAGCGGGTCGGAGAACTGGCAAGTTTGCCTTTCACCTATACTGCAG AAGTTACCAGTGAAACCTTTAACAAGGAAGC

TTTCCTGGCCTCCCGAGGCCTCACTCGTGGTTATTGGACCCAGCTCAGCATGCTGATTCCAGGGCCGGGTGCCCCCAGGTACCCCTGGGGCAGCACATCA

TCCCTCAGCTGCCTTCTCAACG GTGATCCTTACCAGCTTCTGCAGGGAGACGGGCCTGCCTTGATGCCTCCGGTGCCCCTCGAGCCACCCAGGAGCCTC

TTTG GTTCATGGCAGGATTACTACACGTGGCGGGGCCTCAGCCTGGACTCCCCCATGGCTGTGCTTCTCACCTACCCACTGACGGTGTACTATGTCATC

ACCCACCTGGTACCCCAGTCCT TCCCTGAGCTCAACATCCAGAACAAGCAATCCCTGAAGATCCACGTGGTGGAGGCTGGCAAGGAATTCGATCTCGTC

ATGGTGTTTTGG GAGCTCTTGGTCCTTCTCCCCCATGTGGCCCTGGAGCTACAGTTTGTGGGTGACAGCCTGCCACCTGAGAGTGACCAGCAGCATTTT

ACTATGCAGAGG GATGGACCTGAGGTGTCTCTGCGTCCTGGTTCTGGAGTATCAGCACGGTTCAACTCTGGGACTAAGGAGAAGGGAGGTCGAAGGGAC

CTGCAAATCAGGGTGTCTGCCAGGCCCTATCACCTGCTCCAGGGACCCAAGCCTGACCTGGTTATTG GATTTAACTCCGGCTTTGGTCTCAAAGATACA

TGGCTGAGCTCTCTACCCCGGTTACAG TCTCTCCGAGTGCCAGCATTCTTCACTGAGAGCAGTGAGTACGGCTGTGTGATGGACGATCAGACTATGGCG

GTGGCCACCGGAGGGGGCACCAGCTCGCCACAGCCCAACCCCTTCCGCTCCCCATTCCGCCTTAGAGCAGCTGACAACTGTATGCCCTG GTACTGCAAC

GCCTTCATCTTCCATTTGGTCTACAAGCCTCCCCAAGGCGGCACAGTCCGCTCGGCTCCCGGCCCTGCACCTAGACCCCCAACTCCCGCTGCACCTCCTG

TCCCGGCTCGAAGGCGCCGAGGAGAAAAGAAAGCTGCACGCGGGCCCCGCCGGCGCAGATGAGAGCGGACTTGGCAGCCGTCCATTCCCAAGCATGCGCC

CTAAAGGAAAACATTCCAAGGCCCAGGGAAGACTGATTGTCGGAACACAAAAGGTTAAATAAAATTACTTGTTTGAAA
Translation
 - UNI37877 - MEKVEPQEGGEPAPPSKRFPQEAKPAPESEVTQQEASREEGSREERPEDERAPEKRKGQKNA AEAAPLHLSCLLLVTDEHGTILG

IDLLMDGAQGSVGQNPGTENLAPRAYALLCHSMACPMGSGDPRKPRQLTVGDAHLHR RELESLVPRLGVKLAKTPMRTWGPRPGFTFASLRARTCHVCH

KHSFEVKLTPC CPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLSAFMERVGELASLPFTYTAE EVTSETFNKEAFLASRGLTRGYWTQLSMLIPG

PGAPRYPWGSTSSLSCLLNG GDPYQLLQGDGPALMPPVPLEPPRSLFG GSWQDYYTWRGLSLDSPMAVLLTYPLTVYYVITHLVPQSF FPELNIQNK

QSLKIHVVEAGKEFDLVMVFW ELLVLLPHVALELQFVGDSLPPESDQQHFTMQR DGPEVSLRPGSGVSARFNSGTKEKGGRRDLQIRVSARPYHLLQG

PKPDLVIG GFNSGFGLKDTWLSSLPRLQ SLRVPAFFTESSEYGCVMDDQTMAVATGGGTSSPQPNPFRSPFRLRAADNCMPW WYCNAFIFHLVYKPP

QGGTVRSAPGPAPRPPTPAAPPVPARRRRGEKKAARGPRRRR

For any suggestions or comments, please send an email to unitrap@crg.es