Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040850 (Psme4)
Chromosomal location
Chr 11: 30671775 - 30780334 (+)
Description
proteasome (prosome, macropain) activator subunit 4 Gene [Source:MGI (curated);Acc:Psme4-001]
RefSeq_dna
NM_134013 
RefSeq_peptide
NP_598774.2 
UniGene
Mm.469722 Mm.475978 
MGI
MGI:2143994 
Uniprot/SWISSPROT
Q5SSW2 
Uniprot/SPTREMBL
Q5SSW0 Q5SSW1 
Human Ortholog
ENSG00000068878 (PSME4)
Omim not available
UniTrap UNI20018
Vector Insertion
Chr 11: 30672588 - 30691091
Public Clones IST11603G3 (tigm) IST14732E8 (tigm)
Private Clones OST374933 (lexicon) OST281288 (lexicon) OST198656 (lexicon) OST194862 (lexicon)
OST130890 (lexicon) OST116754 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27863
Vector Insertion
Chr 11: 30692039 - 30702813
Public Clones not available
Private Clones OST45544 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9053
Vector Insertion
Chr 11: 30704962 - 30705027
Public Clones XK055 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1176
Vector Insertion
Chr 11: 30707826 - 30709835
Public Clones AY0105 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9092
Vector Insertion
Chr 11: 30732631 - 30734085
Public Clones XK518 (baygenomics) XK581 (baygenomics) XK326 (baygenomics) XK583 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4006
Vector Insertion
Chr 11: 30743589 - 30745179
Public Clones AR0054 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4021
Vector Insertion
Chr 11: 30745179 - 30745334
Public Clones AQ0778 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3999
Vector Insertion
Chr 11: 30745827 - 30745898
Public Clones AR0160 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4591
Vector Insertion
Chr 11: 30748046 - 30748200
Public Clones XR0168 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35041
Vector Insertion
Chr 11: 30748200 - 30750602
Public Clones IST13375A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8133
Vector Insertion
Chr 11: 30756029 - 30756116
Public Clones RRG348 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101400
Sequence
CAGACACTACTTAGCCCAGAAAAGATTAAAGAAGGACAGAAGCGTCAACAAGATAAGAATGCTGATGCCCTAAG GAACTATGAATGTTTGGTAAATACT

TTACTAGATGGTGTGGAGCAAAGAAATCT GCCTTGGAAATTTGAGCATATAGGAATCGGGCTTCTGTCTCTACTCCTAAGGGATGACAGAGTGTTGCCT

CTTCGTGCCATACGTTTTTTTGTTGAAAATCTCAACCATGATGCAATTGTTGTTCGAAAG ATGGCTATCTCAGCTGTTGCTGGTATTCTCAAGCAGCTA

AAGAGAACTCACAAAAAGCTGACTATCAACCCTTATGAAATCA - UNI4006 - - UNI4021 - GTGGATGTCCTAAACCTACCAAAATTCTTGCT

GGTGATAGACCTGATAACCATTGGTTGCATTATGATAGTAAAAATATACCAAGAACAAAAAAAGAATGGGAGTCAAGTTGCTTTGTTGAAAAAACTCACT

GGGGATACTACAACTGGCCAAA - UNI3999 - - UNI4021 - GAATATGGTTGTTTATGCTGGTGTGGAAGAACAGCCTAAACTTGGCAGAAGCA

GGGAGGATATGATAGAG - UNI3999 - GCAGAACAGATTATATATGATCGTTTTTCTGATCCTAAGTTTGTTGAGCAGTTAATCACATTTCTATCTT

TAGAAGACAGAAAAGGAAGAGATAAGTTTAGTCCCCGGCGTTTCTGCCTCTTTAAG - UNI4591 - GGTATATTTAGAAATTTTGATGATGCTTTTC

TGCCTGTTCTGAAGCCCCATTTAGAACGTTTGGTTGCAGATTCTCATGAAAGTACCCAGAGATGTGTTGCAGAAATTATAGCTGGTTTAATCAGAGGTTC

TAAGCATTGGACGTTTGAGAAG - UNI4591 - - UNI35041 - GTGGAGAAGCTTTGGGAGCTCCTGTGCCCGCTGCTGAGAACGGCACTGTCCA

ACATGACAGTGGAGACATACAATGACTGGGGGACCTGTATAGCCACTTCCTGT GAAAGCAGAGATCCCCGGAAGCTTCACTGGCTTTTTGAGCTGCTCT

TGGAGTCACCATTGAGTGGTGAAGGGGGGTCCTTTGTAGATGCATG CCGACTCTATGTGCTACAAGGTGGCCTTGCCCAGCAAGAGTGGAGAGTCCCTG

AACTATTGCACAGACTTCTGAAGTACTTGGAACCAAAACTCACCCAGGTTTACAAAAATGTCAGAGAAAGAATAGGAAG TGTGCTGACCTACATATTTA

TGATAGATGTTTCTTTGCCAAATACTGCTCCAACAACATCTCCTTGTATCCCTGAGTTTACTGCTCGCGTCCTAGAAAAACTGAAACCACTCACAGATGT

GGATGAAGAAATTCAGAACCATGTTATGGAAGAAAATGGCATTGGTGAAGAAGATGAACGAACTCAGGGCATTAAACTCTTAAAAACTA - UNI8133 

- TATTGAAATGGCTTATGGCAAGTGCAGGAAGATCTTTTTCTACAGCAGTCAAAGAGCAACTTCAGCTTCTGCCTTTGTTCTTTAAG - UNI8133 -

 GATCCTATGTAG
Translation
    - UNI4006 - - UNI4021 -  - UNI3999 - - UNI4021 -  - UNI3999 -  - UNI4591 -  - UNI4591 - - UNI350

41 - MTVETYNDWGTCIATSC ESRDPRKLHWLFELLLESPLSGEGGSFVDAC CRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKNVRERIGS

 SVLTYIFMIDVSLPNTAPTTSPCIPEFTARVLEKLKPLTDVDEEIQNHVMEENGIGEEDERTQGIKLLKTI - UNI8133 - ILKWLMASAGRSFST

AVKEQLQLLPLFFK - UNI8133 - DPM
Transcript ENSMUST00000093224
Sequence
ATTCCAGGGGCGCGGCCGAGTCCGGGGAGACCCAGTCTCCTCGTTGCTTTCCGTGGGACTTCTGGGTCCTGTCGGTCGCCTCTCACGATCAGCGTTCTGG

TCCTTTCTCTTGACGTGCCAGGCTCTGGGGAGCCACAGGCGTACCCGGGCATAGGGACGAGCGGCTCCCATTGGTTCTCCCTGGGGTTCTGCGCTTGGAG

CTGCGGGATAGAGAGCTTCGGTCTTTGGGGAAGCGACTCCTGTCCTTGCTTCTGTGGTTTTTTTGG - UNI20018 - TTATATCCGACTTTATGGGA

GAAAATTTAGCAAAGAAGATCATGTTCTTTTTATTAAGTTACTGTATGAGCTGGTATCAATTCCAAAACTAGAAATCAGCATGATGCAGGGATTTGCCCG

TCTCTTGATCAACTTGTTAAA AAAAAAGGAACTTCTTTCAAGAGATGATTTAGAGTTACCTTGGAGACCACTTTATGACTTGGTAGAAAGAATATTATA

TTCCAAGACAGAGCACCTGAGATTAAATTCATTTCCTAA - UNI27863 - TTCTATAGAAAATGTTCTCAAAACACTGGTGAAAAGCTGCCGACC A

TACTTTCCAGCAGATTCAACAGCAGAAATGTTAGAAGAATGGCGGCCTTTAATGTGTCCTTTTGATGTAACAATGCAAAAGGCCATCAGTTATTTTGAAA

TATTTCTTCCTACCTCCCTTCCTCCAGAACTGCATCATAAAGGTTTTAA - UNI9053 - ACTTTGGTTTGATGAATTAATTGGCCTTTGGGTTTCAG

TGCAAAATCTCCCACAGTGGGAGGGG - UNI9053 - CAATTAGTAAATCTCTTTGCTCGATTGGCTACAGATAATATAGGATACATAGATTGGGATC

CATATGTACCGAAG ATATTTACAAGAATTCTGAGAAGCCTGAACCTCCCAGTGGGAAGCAGTCAAGTTTTAGTCCCAAGATTTTTAACAAATGCTTATG

ATATAGGACATGCTGTAATATGGATCACCGCAATGATG - UNI1176 - GGTGGACCAAGTAAATTAGTACAAAAACATTTAGCTGGTTTGTTTAACA

GCATCACATCATTTTATCATCCTTCAAATAATGGGCGTTGGCTG AACAAGTTAATGAAACTCCTTCAGCGGTTGCCAAACAGTGTTGTTAGGAGATTAC

ATCGTGAAAGATTCAAGAAGCCCTCCTGGTTAACTCCTGTGCCTGAAAGCCATAAGCTTACTGATGAAGATGTTACAGACTTTGTACAATGCATTATTCA

GCCTGTCCTCTTGGCTATGTTTAGCAAAACTGGTAGTCTAGAAGCAGCCCAGGCTCTGCAGAACCTTGCACTTATGAGACCTGAGTTAGTAATACCCCCT

GTGCTTGAAAG AACATACCCTGCTTTAGAGACATTAACAGAACCTCACCAGCTCACAGCTACTTTAAATTGTGTAATTGGAGTAGCCCGAAGTTTGGTA

TCAGGCAGCAAATGGTTTCCCGAAGGGCCAACACACATGCTACCTCTGTTGATGAGAGCATTGCCTGGGGTAGATCCAAACGACTTTAGTAAGTGCATG 

ATCACATTCCAATTTATAGGAACATTTTCTACTCTGGTGCCTTTAGTAGACTGTTCATCTGTACTGCAAGAAAGAAATGACCTCACAGAA ATTGAAAAA

GAACTTTGTTCGGCAACAGCTGAATTTGAGGATTTTGTGTTACAATTTATGGACAG ATGCTTTGGACTAATAGAAAGTAGTACATTGGAGCAAACAAGG

GAAGAGACAGAAACAGAGAAAATGACTCATTTGGAGAGTTTGGTTGAATTAGGCTTATCTTCTACGTTTAGTACAATCCTCACACAATGTTCCAAAGACA

TATTTATG GTGGCCCTTCAGAAGGTCTTTAACTTTTCTGTTTCACATATATTTGAAACAAGAGTTGCAGGTCGCATGGTGGCAGACATGTGCCGAGCTG

CTGTGAAG TGTTGCCCAGAAGAATCCCTGAAGCTGTTTGTTCCCCACTGCTATGGTGTTATAACTCAGCTTACAATGA ATGATGATGTATTGAATGAA

GAAGAGCTAGACAAGGAGTTGCTGTGGAACCTTCAGCTTCTGTCTGAG ATTACTCGTGTAGACGGGAAGAAGTTACTTCTGTATAGGGAGCAGCTTGTA

AAGATTCTCCAGCGAACCTTACACCTGACCTGTAAGCAGGGCTACACGCTGTCTTGCAACCTTCTGCATCATCTTCTTCGTTCTACCACACTAATCTACC

CTACAGAGTACTGCAGTGTTCCGGGGGGCTTTAACAAGCCGCCTTCTGAATACTTCCCTGTCAAG GACTGGGGTAAGCCTGGAGATTTGTGGAATCTGG

GGATCCAGTGGCATGTTCCTTCTTCAGAAGAAGTCTCTTTTGCCTTCTATTTGTTAGACTCCTTTCTTCAGCCTGAGCTTATCAAACTCCAGTGTTGTGG

AGATGGAGAACTTGAAATGTCTAG AGATGATATTCTACAGAGTCTGACTATAGTACACAGCTGCTTGATTGGTTCAGGGAACCTTCTACCTCCATTGAA

AGGAGAGGCAGTTACTAACTT GGTACCAAGTATGGTCTCCTTAGAGGAAACAAAATTGTATACCGGACTGGAACATG ACCTATCCAGAGAAAACTACC

GAGAAGTAATTGCTAGTGTCATAAGGAAACTTCTTA GCCACATACTTGATAATTCAGAAGATGATACCAAATCACTGTTTCTCATCATAAAG ATCATT

GGAGACCTTCTGCACTTCCAAGGATCTCATAAACATGAATTTGACTCTCGATGGAAAAGCTTTAACTTAGTAAAGAAATCAATGGAAAATCGG - UNI9

092 - CTCCATGGAAAAAAGCAACATATCAGAGCATTACTAATTGACAGAGTGATGCTGCAGCATGAG TTGCGAACACTAACTGTTGAGGGTTGTGAG

TACAAAAAAATACATCAAGATATGATCAGAGATCTTCTTCGATTATCAACAAGCTCATACAGTCAG GTCAGAAACAAAGCTCAGCAAACATTTTTTGCT

GCTTTGGGGGCATATAACTTCTGTTGCAGAGATATTATCCCCTTGGTTTTGGAATTCCTACGGCCTGATAGAAAGGATGTCACACAGCAGCAGTTCAAG 

GGCGCCTTATATTGTCTACTTGGAAATCACAGTGGTGTGTGCCTGGCAAACCTTCATGATTGGGACTGTATTGTGCAGACCTGGCCAGCACTTGTTTCTT

CAGGGCTTAGCCAAGCAATGTCACTGGAAAAGCCATCAATAGTGAGACTATTTGATGACCTTGCTGAAAAGATTCATAGACAATATGAAACAATTGGCTT

GGATTTTACA ATTCCAAAGTCATGTGCTGCAATAGCAGAATTACTTCAACAATCAAAGAATCCTTCCATTAGCCAGACACTACTTAGCCCAGAAAAGAT

TAAAGAAGGACAGAAGCGTCAACAAGATAAGAATGCTGATGCCCTAAG GAACTATGAATGTTTGGTAAATACTTTACTAGATGGTGTGGAGCAAAGAAA

TCT GCCTTGGAAATTTGAGCATATAGGAATCGGGCTTCTGTCTCTACTCCTAAGGGATGACAGAGTGTTGCCTCTTCGTGCCATACGTTTTTTTGTTGA

AAATCTCAACCATGATGCAATTGTTGTTCGAAAG ATGGCTATCTCAGCTGTTGCTGGTATTCTCAAGCAGCTAAAGAGAACTCACAAAAAGCTGACTAT

CAACCCTTATGAAATCA - UNI4006 - - UNI4021 - GTGGATGTCCTAAACCTACCAAAATTCTTGCTGGTGATAGACCTGATAACCATTGGTT

GCATTATGATAGTAAAAATATACCAAGAACAAAAAAAGAATGGGAGTCAAGTTGCTTTGTTGAAAAAACTCACTGGGGATACTACAACTGGCCAAA - U

NI3999 - - UNI4021 - GAATATGGTTGTTTATGCTGGTGTGGAAGAACAGCCTAAACTTGGCAGAAGCAGGGAGGATATGATAGAG - UNI399

9 - GCAGAACAGATTATATATGATCGTTTTTCTGATCCTAAGTTTGTTGAGCAGTTAATCACATTTCTATCTTTAGAAGACAGAAAAGGAAGAGATAAG

TTTAGTCCCCGGCGTTTCTGCCTCTTTAAG - UNI4591 - GGTATATTTAGAAATTTTGATGATGCTTTTCTGCCTGTTCTGAAGCCCCATTTAGAA

CGTTTGGTTGCAGATTCTCATGAAAGTACCCAGAGATGTGTTGCAGAAATTATAGCTGGTTTAATCAGAGGTTCTAAGCATTGGACGTTTGAGAAG - U

NI4591 - - UNI35041 - GTGGAGAAGCTTTGGGAGCTCCTGTGCCCGCTGCTGAGAACGGCACTGTCCAACATGACAGTGGAGACATACAATGAC

TGGGGGACCTGTATAGCCACTTCCTGT GAAAGCAGAGATCCCCGGAAGCTTCACTGGCTTTTTGAGCTGCTCTTGGAGTCACCATTGAGTGGTGAAGGG

GGGTCCTTTGTAGATGCATG CCGACTCTATGTGCTACAAGGTGGCCTTGCCCAGCAAGAGTGGAGAGTCCCTGAACTATTGCACAGACTTCTGAAGTAC

TTGGAACCAAAACTCACCCAGGTTTACAAAAATGTCAGAGAAAGAATAGGAAG TGTGCTGACCTACATATTTATGATAGATGTTTCTTTGCCAAATACT

GCTCCAACAACATCTCCTTGTATCCCTGAGTTTACTGCTCGCGTCCTAGAAAAACTGAAACCACTCACAGATGTGGATGAAGAAATTCAGAACCATGTTA

TGGAAGAAAATGGCATTGGTGAAGAAGATGAACGAACTCAGGGCATTAAACTCTTAAAAACTA - UNI8133 - TATTGAAATGGCTTATGGCAAGTG

CAGGAAGATCTTTTTCTACAGCAGTCAAAGAGCAACTTCAGCTTCTGCCTTTGTTCTTTAAG - UNI8133 - ATCGCTCCAGTGGAAAATGACAATA

GTTATGATGAACTGAAAAGAGATGCAAAGCTCTGTTTGTCACTAATGTCTCAGGGGTTGCTGTACCCTCAACAAGTGCCTTTGATACTTCAGGTGCTAAG

CCAG ACAGCAAGAAGCAGTTCTTGGCATGCAAGATATACAGTGCTGACCTACCTCCAGACCATGGTATTTTATAACCTCTTTATTTTCCTAAACAATGA

AGATGCAGTTAAAGACATCAGATGGCTGATTATATGCCTTTTGGAGGATGAACAGTTAGAG GTTCGAGAAATGGCTGCTACCACCTTAAGTGGTCTGTT

ACAGTGTAACTTCCTTACCATGGACAGTGCTATGCAGATTCATTTTGAGCAACTTTGCAAAACAAAACTACCCAAGAAAAGAAAACGAGACCCTGGTTCT

GTGGGAGATACCATTCCTTCTGCAG AGTTGGTCAAACGTCATGCTGGTGTGCTTGGACTTGGTGCATGTGTTCTTTCTAGCCCTTATGATGTTCCTACC

TGGATGCCCCAGCTCCTTATGAACCTCAGTGCACATTTGAATGATCCTCAGCCTATTGAG ATGACTGTAAAGAAGACCTTATCCAATTTCCGAAGGACA

CATCATGACAACTGGCAAGAACACAAGCAGCAGTTCACTGATGACCAGCTGCTTGTCCTCACTGACCTCCTTGTGTCACCATGCTATTATGCATAGAGGG

 ATGACTAGTCCTCATTCTGGGCTCATTTCATCAAAAACTCCAGATCCTCAGGTATCATCCGTGGTGACTCTGCAAGTTTCACAACTCAGCTTCTCTTGA

GCTTTCATCATTTTGGTGGCTTCTCTGTTTGGCCTCATTAGTCTTCGCTCACAGGTTCTCAGCTGCCATTTGATTTCCTAACTTGTTCTGAAGTGTTCCC

TGAGTACTGATCACTTTTTCTTTTGAGACATATGACAAAGTCACAAAGTCTCAGACTAGAAGTAGCCTAGTACTATCATGGTATTATGACCAAACAGTCT

CGAACGTTGTTAAAAACAACAATGTCCTCGGAATGGAGAATGCTCATCAATTATGTAGGTTCTCTCATTTCATTCATCTCACGTTATTTTGAGTTCTTCC

CCAAAGGCTGTTGAGTTTAGCATTAGTAGGGCCATGGGTCATGAATCTGAAGTTTTGACCGCCTTGTGTCTAGAGAGCCATGAAGAGAAAAGGATCAAAG

GGGGCAAAGTCTCAGAGTTAACCTAGAACCTGACACGCTCAACCACACTGCAGATGTCTGTATCTCCACAGACTGGAGTTTTTGGTGCTGAGTAAGAGCC

AATTGCTGAAAAACTGGGGGTTTGGTGAATAAATTTTAGACTGATTTGTATGTGTATACAATGTGTGATTTT
Translation
IPGARPSPGRPSLLVAFRGTSGSCRSPLTISVLVLSLDVPGSGEPQAYPGIGTSGSHWFSLGFCAWSCGIESFGLWGSDSCPCFCGFFG - UNI20018

 - GYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFARLLINLLK KKKELLSRDDLELPWRPLYDLVERILYSKTEHLRLNSFPN - UNI27

863 - NSIENVLKTLVKSCRP PYFPADSTAEMLEEWRPLMCPFDVTMQKA - UNI9053 -  - UNI9053 -   - UNI1176 -         

        - UNI9092 -         - UNI4006 - - UNI4021 -  - UNI3999 - - UNI4021 -  - UNI3999 -  - UNI4591

 -  - UNI4591 - - UNI35041 -     - UNI8133 -  - UNI8133 -      
Transcript ENSMUST00000041231
Sequence
CACCAGAAGAGCCGGAGGGGTCCGGGCCGAGCAGCCGCTGCCACCGCCAACGAACCGGGTGCCGCGCGGGGTCCAGCAGCGCGCCGGGCAGCCGGGGCGG

GAGGGGGGCCCAGCGGTCGGGCCGAGGGCGAGGCGACGCGGACGAGGCTGAGCCCGCAGCGGGGCGGGGGCCGGGGCCGGGGGTCGGGCCGGGGGCGGCC

CCGGGCTAATGGAGGCTCCGGAGCGGGCGGGCGGCGGGGAGCCCCCCGAGCCTGGCGGGCGGCCGGTACTGGGCCCGCGGGCCTTCGTCCCGCAGAAGGA

GATCGTGTACAACAAGCTTCTGCCCTATGCCGAGCGGCTGGACGCCGAGTCCGACTTGCAGCTGGCACAGATCAAGAGCAACCTGGGCCGGGCCGTGCAG

CTCCAAGAGCTGTGGCCCGGGGGCCTCTTCTGGACGCGGAAACTCTCCAC - UNI20018 - TTATATCCGACTTTATGGGAGAAAATTTAGCAAAGA

AGATCATGTTCTTTTTATTAAGTTACTGTATGAGCTGGTATCAATTCCAAAACTAGAAATCAGCATGATGCAGGGATTTGCCCGTCTCTTGATCAACTTG

TTAAA AAAAAAGGAACTTCTTTCAAGAGATGATTTAGAGTTACCTTGGAGACCACTTTATGACTTGGTAGAAAGAATATTATATTCCAAGACAGAGCAC

CTGAGATTAAATTCATTTCCTAA - UNI27863 - TTCTATAGAAAATGTTCTCAAAACACTGGTGAAAAGCTGCCGACC ATACTTTCCAGCAGATT

CAACAGCAGAAATGTTAGAAGAATGGCGGCCTTTAATGTGTCCTTTTGATGTAACAATGCAAAAGGCCATCAGTTATTTTGAAATATTTCTTCCTACCTC

CCTTCCTCCAGAACTGCATCATAAAGGTTTTAA - UNI9053 - ACTTTGGTTTGATGAATTAATTGGCCTTTGGGTTTCAGTGCAAAATCTCCCACA

GTGGGAGGGG - UNI9053 - CAATTAGTAAATCTCTTTGCTCGATTGGCTACAGATAATATAGGATACATAGATTGGGATCCATATGTACCGAAG A

TATTTACAAGAATTCTGAGAAGCCTGAACCTCCCAGTGGGAAGCAGTCAAGTTTTAGTCCCAAGATTTTTAACAAATGCTTATGATATAGGACATGCTGT

AATATGGATCACCGCAATGATG - UNI1176 - GGTGGACCAAGTAAATTAGTACAAAAACATTTAGCTGGTTTGTTTAACAGCATCACATCATTTTA

TCATCCTTCAAATAATGGGCGTTGGCTG AACAAGTTAATGAAACTCCTTCAGCGGTTGCCAAACAGTGTTGTTAGGAGATTACATCGTGAAAGATTCAA

GAAGCCCTCCTGGTTAACTCCTGTGCCTGAAAGCCATAAGCTTACTGATGAAGATGTTACAGACTTTGTACAATGCATTATTCAGCCTGTCCTCTTGGCT

ATGTTTAGCAAAACTGGTAGTCTAGAAGCAGCCCAGGCTCTGCAGAACCTTGCACTTATGAGACCTGAGTTAGTAATACCCCCTGTGCTTGAAAG AACA

TACCCTGCTTTAGAGACATTAACAGAACCTCACCAGCTCACAGCTACTTTAAATTGTGTAATTGGAGTAGCCCGAAGTTTGGTATCAGGCAGCAAATGGT

TTCCCGAAGGGCCAACACACATGCTACCTCTGTTGATGAGAGCATTGCCTGGGGTAGATCCAAACGACTTTAGTAAGTGCATG ATCACATTCCAATTTA

TAGGAACATTTTCTACTCTGGTGCCTTTAGTAGACTGTTCATCTGTACTGCAAGAAAGAAATGACCTCACAGAA ATTGAAAAAGAACTTTGTTCGGCAA

CAGCTGAATTTGAGGATTTTGTGTTACAATTTATGGACAG ATGCTTTGGACTAATAGAAAGTAGTACATTGGAGCAAACAAGGGAAGAGACAGAAACAG

AGAAAATGACTCATTTGGAGAGTTTGGTTGAATTAGGCTTATCTTCTACGTTTAGTACAATCCTCACACAATGTTCCAAAGACATATTTATG GTGGCCC

TTCAGAAGGTCTTTAACTTTTCTGTTTCACATATATTTGAAACAAGAGTTGCAGGTCGCATGGTGGCAGACATGTGCCGAGCTGCTGTGAAG TGTTGCC

CAGAAGAATCCCTGAAGCTGTTTGTTCCCCACTGCTATGGTGTTATAACTCAGCTTACAATGA ATGATGATGTATTGAATGAAGAAGAGCTAGACAAGG

AGTTGCTGTGGAACCTTCAGCTTCTGTCTGAG ATTACTCGTGTAGACGGGAAGAAGTTACTTCTGTATAGGGAGCAGCTTGTAAAGATTCTCCAGCGAA

CCTTACACCTGACCTGTAAGCAGGGCTACACGCTGTCTTGCAACCTTCTGCATCATCTTCTTCGTTCTACCACACTAATCTACCCTACAGAGTACTGCAG

TGTTCCGGGGGGCTTTAACAAGCCGCCTTCTGAATACTTCCCTGTCAAG GACTGGGGTAAGCCTGGAGATTTGTGGAATCTGGGGATCCAGTGGCATGT

TCCTTCTTCAGAAGAAGTCTCTTTTGCCTTCTATTTGTTAGACTCCTTTCTTCAGCCTGAGCTTATCAAACTCCAGTGTTGTGGAGATGGAGAACTTGAA

ATGTCTAG AGATGATATTCTACAGAGTCTGACTATAGTACACAGCTGCTTGATTGGTTCAGGGAACCTTCTACCTCCATTGAAAGGAGAGGCAGTTACT

AACTT GGTACCAAGTATGGTCTCCTTAGAGGAAACAAAATTGTATACCGGACTGGAACATG ACCTATCCAGAGAAAACTACCGAGAAGTAATTGCTAG

TGTCATAAGGAAACTTCTTA GCCACATACTTGATAATTCAGAAGATGATACCAAATCACTGTTTCTCATCATAAAG ATCATTGGAGACCTTCTGCACT

TCCAAGGATCTCATAAACATGAATTTGACTCTCGATGGAAAAGCTTTAACTTAGTAAAGAAATCAATGGAAAATCGG - UNI9092 - CTCCATGGAA

AAAAGCAACATATCAGAGCATTACTAATTGACAGAGTGATGCTGCAGCATGAG TTGCGAACACTAACTGTTGAGGGTTGTGAGTACAAAAAAATACATC

AAGATATGATCAGAGATCTTCTTCGATTATCAACAAGCTCATACAGTCAG GTCAGAAACAAAGCTCAGCAAACATTTTTTGCTGCTTTGGGGGCATATA

ACTTCTGTTGCAGAGATATTATCCCCTTGGTTTTGGAATTCCTACGGCCTGATAGAAAGGATGTCACACAGCAGCAGTTCAAG GGCGCCTTATATTGTC

TACTTGGAAATCACAGTGGTGTGTGCCTGGCAAACCTTCATGATTGGGACTGTATTGTGCAGACCTGGCCAGCACTTGTTTCTTCAGGGCTTAGCCAAGC

AATGTCACTGGAAAAGCCATCAATAGTGAGACTATTTGATGACCTTGCTGAAAAGATTCATAGACAATATGAAACAATTGGCTTGGATTTTACA ATTCC

AAAGTCATGTGCTGCAATAGCAGAATTACTTCAACAATCAAAGAATCCTTCCATTAGCCAGACACTACTTAGCCCAGAAAAGATTAAAGAAGGACAGAAG

CGTCAACAAGATAAGAATGCTGATGCCCTAAG GAACTATGAATGTTTGGTAAATACTTTACTAGATGGTGTGGAGCAAAGAAATCT GCCTTGGAAATT

TGAGCATATAGGAATCGGGCTTCTGTCTCTACTCCTAAGGGATGACAGAGTGTTGCCTCTTCGTGCCATACGTTTTTTTGTTGAAAATCTCAACCATGAT

GCAATTGTTGTTCGAAAG ATGGCTATCTCAGCTGTTGCTGGTATTCTCAAGCAGCTAAAGAGAACTCACAAAAAGCTGACTATCAACCCTTATGAAATC

A - UNI4006 - - UNI4021 - GTGGATGTCCTAAACCTACCAAAATTCTTGCTGGTGATAGACCTGATAACCATTGGTTGCATTATGATAGTAAA

AATATACCAAGAACAAAAAAAGAATGGGAGTCAAGTTGCTTTGTTGAAAAAACTCACTGGGGATACTACAACTGGCCAAA - UNI3999 - - UNI40

21 - GAATATGGTTGTTTATGCTGGTGTGGAAGAACAGCCTAAACTTGGCAGAAGCAGGGAGGATATGATAGAG - UNI3999 - GCAGAACAGATT

ATATATGATCGTTTTTCTGATCCTAAGTTTGTTGAGCAGTTAATCACATTTCTATCTTTAGAAGACAGAAAAGGAAGAGATAAGTTTAGTCCCCGGCGTT

TCTGCCTCTTTAAG - UNI4591 - GGTATATTTAGAAATTTTGATGATGCTTTTCTGCCTGTTCTGAAGCCCCATTTAGAACGTTTGGTTGCAGATT

CTCATGAAAGTACCCAGAGATGTGTTGCAGAAATTATAGCTGGTTTAATCAGAGGTTCTAAGCATTGGACGTTTGAGAAG - UNI4591 - - UNI35

041 - GTGGAGAAGCTTTGGGAGCTCCTGTGCCCGCTGCTGAGAACGGCACTGTCCAACATGACAGTGGAGACATACAATGACTGGGGGACCTGTATAG

CCACTTCCTGT GAAAGCAGAGATCCCCGGAAGCTTCACTGGCTTTTTGAGCTGCTCTTGGAGTCACCATTGAGTGGTGAAGGGGGGTCCTTTGTAGATG

CATG CCGACTCTATGTGCTACAAGGTGGCCTTGCCCAGCAAGAGTGGAGAGTCCCTGAACTATTGCACAGACTTCTGAAGTACTTGGAACCAAAACTCA

CCCAGGTTTACAAAAATGTCAGAGAAAGAATAGGAAG TGTGCTGACCTACATATTTATGATAGATGTTTCTTTGCCAAATACTGCTCCAACAACATCTC

CTTGTATCCCTGAGTTTACTGCTCGCGTCCTAGAAAAACTGAAACCACTCACAGATGTGGATGAAGAAATTCAGAACCATGTTATGGAAGAAAATGGCAT

TGGTGAAGAAGATGAACGAACTCAGGGCATTAAACTCTTAAAAACTA - UNI8133 - TATTGAAATGGCTTATGGCAAGTGCAGGAAGATCTTTTTC

TACAGCAGTCAAAGAGCAACTTCAGCTTCTGCCTTTGTTCTTTAAG - UNI8133 - ATCGCTCCAGTGGAAAATGACAATAGTTATGATGAACTGAA

AAGAGATGCAAAGCTCTGTTTGTCACTAATGTCTCAGGGGTTGCTGTACCCTCAACAAGTGCCTTTGATACTTCAGGTGCTAAGCCAG ACAGCAAGAAG

CAGTTCTTGGCATGCAAGATATACAGTGCTGACCTACCTCCAGACCATGGTATTTTATAACCTCTTTATTTTCCTAAACAATGAAGATGCAGTTAAAGAC

ATCAGATGGCTGATTATATGCCTTTTGGAGGATGAACAGTTAGAG GTTCGAGAAATGGCTGCTACCACCTTAAGTGGTCTGTTACAGTGTAACTTCCTT

ACCATGGACAGTGCTATGCAGATTCATTTTGAGCAACTTTGCAAAACAAAACTACCCAAGAAAAGAAAACGAGACCCTGGTTCTGTGGGAGATACCATTC

CTTCTGCAG AGTTGGTCAAACGTCATGCTGGTGTGCTTGGACTTGGTGCATGTGTTCTTTCTAGCCCTTATGATGTTCCTACCTGGATGCCCCAGCTCC

TTATGAACCTCAGTGCACATTTGAATGATCCTCAGCCTATTGAG ATGACTGTAAAGAAGACCTTATCCAATTTCCGAAGGACACATCATGACAACTGGC

AAGAACACAAGCAGCAGTTCACTGATGACCAGCTGCTTGTCCTCACTGACCTCCTTGTGTCACCATGCTATTATGCATAGAGGG ATGACTAGTCCTCAT

TCTGGGCTCATTTCATCAAAAACTCCAGATCCTCAGGTATCATCCGTGGTGACTCTGCAAGTTTCACAACTCAGCTTCTCTTGAGCTTTCATCATTTTGG

TGGCTTCTCTGTTTGGCCTCATTAGTCTTCGCTCACAGGTTCTCAGCTGCCATTTGATTTCCTAACTTGTTCTGAAGTGTTCCCTGAGTACTGATCACTT

TTTCTTTTGAGACATATGACAAAGTCACAAAGTCTCAGACTAGAAGTAGCCTAGTACTATCATGGTATTATGACCAAACAGTCTCGAACGTTGTTAAAAA

CAACAATGTCCTCGGAATGGAGAATGCTCATCAATTATGTAGGTTCTCTCATTTCATTCATCTCACGTTATTTTGAGTTCTTCCCCAAAGGCTGTTGAGT

TTAGCATTAGTAGGGCCATGGGTCATGAATCTGAAGTTTTGACCGCCTTGTGTCTAGAGAGCCATGAAGAGAAAAGGATCAAAGGGGGCAAAGTCTCAGA

GTTAACCTAGAACCTGACACGCTCAACCACACTGCAGATGTCTGTATCTCCACAGACTGGAGTTTTTGGTGCTGAGTAAGAGCCAATTGCTGAAAAACTG

GGGGTTTGGTGAATAAATTTTAGACTGATTTGTATGTGTATACAATGTGTGATTTT
Translation
MEAPERAGGGEPPEPGGRPVLGPRAFVPQKEIVYNKLLPYAERLDAESDLQLAQIKSNLGRAVQLQELWPGGLFWTRKLST - UNI20018 - TYIRL

YGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFARLLINLLK KKKELLSRDDLELPWRPLYDLVERILYSKTEHLRLNSFPN - UNI27863 - NS

IENVLKTLVKSCRP PYFPADSTAEMLEEWRPLMCPFDVTMQKAISYFEIFLPTSLPPELHHKGFK - UNI9053 - KLWFDELIGLWVSVQNLPQWE

G - UNI9053 - QLVNLFARLATDNIGYIDWDPYVPK IFTRILRSLNLPVGSSQVLVPRFLTNAYDIGHAVIWITAMM - UNI1176 - GGPSKL

VQKHLAGLFNSITSFYHPSNNGRWL NKLMKLLQRLPNSVVRRLHRERFKKPSWLTPVPESHKLTDEDVTDFVQCIIQPVLLAMFSKTGSLEAAQALQNL

ALMRPELVIPPVLER RTYPALETLTEPHQLTATLNCVIGVARSLVSGSKWFPEGPTHMLPLLMRALPGVDPNDFSKCM ITFQFIGTFSTLVPLVDCSS

VLQERNDLTE IEKELCSATAEFEDFVLQFMDR RCFGLIESSTLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKDIFM VALQKVFNFSVSHI

FETRVAGRMVADMCRAAVK CCPEESLKLFVPHCYGVITQLTMN NDDVLNEEELDKELLWNLQLLSE ITRVDGKKLLLYREQLVKILQRTLHLTCKQG

YTLSCNLLHHLLRSTTLIYPTEYCSVPGGFNKPPSEYFPVK DWGKPGDLWNLGIQWHVPSSEEVSFAFYLLDSFLQPELIKLQCCGDGELEMSR RDDI

LQSLTIVHSCLIGSGNLLPPLKGEAVTNL LVPSMVSLEETKLYTGLEHD DLSRENYREVIASVIRKLLS SHILDNSEDDTKSLFLIIK IIGDLLHF

QGSHKHEFDSRWKSFNLVKKSMENR - UNI9092 - LHGKKQHIRALLIDRVMLQHE LRTLTVEGCEYKKIHQDMIRDLLRLSTSSYSQ VRNKAQQ

TFFAALGAYNFCCRDIIPLVLEFLRPDRKDVTQQQFK GALYCLLGNHSGVCLANLHDWDCIVQTWPALVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQY

ETIGLDFT IPKSCAAIAELLQQSKNPSISQTLLSPEKIKEGQKRQQDKNADALR RNYECLVNTLLDGVEQRNL LPWKFEHIGIGLLSLLLRDDRVLP

LRAIRFFVENLNHDAIVVRK MAISAVAGILKQLKRTHKKLTINPYEIS - UNI4006 - - UNI4021 - SGCPKPTKILAGDRPDNHWLHYDSKN

IPRTKKEWESSCFVEKTHWGYYNWPK - UNI3999 - - UNI4021 - KNMVVYAGVEEQPKLGRSREDMIE - UNI3999 - AEQIIYDRFSDP

KFVEQLITFLSLEDRKGRDKFSPRRFCLFK - UNI4591 - GIFRNFDDAFLPVLKPHLERLVADSHESTQRCVAEIIAGLIRGSKHWTFEK - UNI

4591 - - UNI35041 - VEKLWELLCPLLRTALSNMTVETYNDWGTCIATSC ESRDPRKLHWLFELLLESPLSGEGGSFVDAC CRLYVLQGGLAQ

QEWRVPELLHRLLKYLEPKLTQVYKNVRERIGS SVLTYIFMIDVSLPNTAPTTSPCIPEFTARVLEKLKPLTDVDEEIQNHVMEENGIGEEDERTQGIK

LLKTI - UNI8133 - ILKWLMASAGRSFSTAVKEQLQLLPLFFK - UNI8133 - IAPVENDNSYDELKRDAKLCLSLMSQGLLYPQQVPLILQV

LSQ TARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLIICLLEDEQLE VREMAATTLSGLLQCNFLTMDSAMQIHFEQLCKTKLPKKRKRD

PGSVGDTIPSAE ELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIE MTVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPC

YYA 

For any suggestions or comments, please send an email to unitrap@crg.es