Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040907 (Atp1a3)
Chromosomal location
Chr 7: 25763192 - 25790914 (-)
Description
ATPase, Na+/K+ transporting, alpha 3 polypeptide Gene [Source:MGI (curated);Acc:Atp1a3-002]
RefSeq_dna
NM_144921 
RefSeq_peptide
NP_659170.1 
UniGene
Mm.44101 
MGI
MGI:88107 
Uniprot/SWISSPROT
Q6PIC6 
Uniprot/SPTREMBL
Q8VCE0 Q8CGD9 Q8R0B0 Q8R0E8 
Human Ortholog
ENSG00000105409 (ATP1A3)
Omim 128235 - DYSTONIA 12  
UniTrap UNI28994
Vector Insertion
Chr 7: 25785800 - 25785938
Public Clones not available
Private Clones OST13706 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31235
Vector Insertion
Chr 7: 25766760 - 25772623
Public Clones IST13578C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102858
Sequence
CCCACGGACCGACAGACGCACGCTCCCACCGCGGCGCGGGCGCTGCAGAGGCCCCCAGCCCGAGCCCGCGCCTGAGCCCATCCTGCGGCCACCGCTCATC

AGTCTGAACGCCGCTCTTCCCGCGGAGCCGCCAAGATGGGG GACAAAAAAGATGACAAGAGCTCGCCCAAGAAGAGCAAGGCCAAAGAGCGCCGGGACC

TGGATGACCTCAAGAAGGAAGTGGCTATG ACAGAGCACAAGATGTCAGTAGAAGAGGTCTGCCGGAAATACAATACTGACTGCGTGCAG - UNI2899

4 - GGTCTGACACACAGTAAAGCCCAGGAGATCCTAGCCCGGGATGGGCCTAACGCCCTCACACCACCGCCCACCACCCCAGAATGGGTCAAGTTCTGC

CGGCAGCTGTTTGGTGGCTTCTCTATCCTGCTGTGGATCGGGGCAATCCTTTGCTTCCTGGCCTATGGCATCCAGGCAGGGACGGAGGATGACCCTTCCG

GTGACAAT CTGTACCTGGGCATAGTGCTGGCCGCAGTCGTGATCATCACCGGCTGCTTCTCCTACTACCAAGAAGCCAAGAGTTCTAAGATCATGGAGT

CCTTCAAGAACATGGTCCCCCAG CAAGCCCTTGTGATCCGGGAAGGTGAAAAGATGCAGGTGAATGCGGAGGAGGTGGTGGTCGGGGACCTGGTGGAGA

TCAAGGGTGGTGACCGGGTGCCAGCTGACCTGCGCATCATCTCGGCCCATGGCTGCAAG GTGGACAACTCCTCCCTGACTGGCGAATCTGAGCCTCAGA

CCCGCTCCCCGGACTGCACACACGACAACCCCCTGGAGACTCGGAACATCACCTTCTTTTCCACCAACTGCGTGGAAG GCACCGCTCGGGGTGTGGTGG

TAGCCACAGGTGACCGCACCGTCATGGGCCGCATTGCCACCCTGGCCTCGGGCTTGGAGGTGGGCAAGACGCCCATCGCCATTGAGATTGAGCATTTCAT

CCAGCTCATTACGGGCGTGGCCGTGTTCCTGGGCGTGTCCTTCTTCATCCTCTCTCTCATTCTGGGTTACACCTGGCTCGAGGCAGTCATCTTCCTCATC

GGCATCATTGTGGCCAATGTCCCAGAGGGGCTGCTGGCTACTGTCACG GTGTGTCTGACGCTGACCGCCAAGCGCATGGCTCGCAAGAACTGCCTGGTG

AAGAACCTGGAGGCGGTGGAGACGCTGGGCTCCACGTCCACCATCTGCTCGGACAAGACCGGCACTCTCACCCAGAACCGCATGACCGTCGCCCACATGT

GGTTTGACAACCAGATCCACGAGGCAGACACCACAGAGGATCAGTCAG GGACCTCTTTCGACAAGAGCTCACACACCTGGGTGGCCCTGTCCCACATCG

CCGGGCTCTGCAACCGGGCCGTCTTCAAGGGCGGGCAGGACAACATCCCAGTACTCAAG AGGGACGTGGCCGGTGATGCCTCCGAGTCTGCCCTGCTTA

AGTGCATTGAGCTGTCCTCGGGTTCCGTAAAGCTGATGCGAGAACGGAACAAGAAAGTGGCTGAGATTCCGTTCAACTCGACCAACAAATACCAG CTAT

CCATCCATGAGACTGAGGATCCCAATGACAACCGGTACCTGCTAGTGATGAAGGGCGCCCCCGAACGCATTCTGGACCGCTGTGCCACCATCCTCCTGCA

GGGCAAGGAGCAGCCTCTGGATGAGGAGATGAAGGAGGCCTTCCAGAATGCCTACCTGGAGCTTGGTGGCCTGGGCGAGCGTGTGCTGG GTTTCTGCCA

TTACTACCTGCCTGAGGAACAGTTCCCCAAGGGCTTTGCCTTTGACTGTGATGACGTGAACTTCACCACAGACAACCTTTGCTTTGTGGGTCTCATGTCC

ATGATTGACCCTCCCCGGGCAGCCGTCCCTGACGCTGTGGGCAAATGCCGAAGCGCAGGCATCAAG GTCATCATGGTCACCGGCGATCACCCCATCACT

GCCAAGGCCATTGCCAAGGGTGTGGGTATCATCTCTGAGGGTAACGAGACTGTCGAAGACATCGCTGCCCGGCTCAACATCCCTGTCAGCCAGGTGAACC

CCAG GGATGCCAAAGCCTGTGTGATTCACGGCACCGACCTCAAGGACTTCACCTCGGAGCAGATTGACGAGATTCTGCAGAACCACACCGAGATCGTCT

TTGCCCGAACCTCCCCTCAGCAGAAGCTCATCATCGTGGAGGGCTGTCAGAGACAG - UNI31235 - GGAGCAATTGTGGCTGTGACTGGCGATGGT

GTGAATGACTCCCCTGCTCTGAAGAAGGCTGACATCGGGGTGGCCATGGGCATTGCTGGCTCTGATGTCTCTAAGCAGGCTGCCGACATGATTCTGCTGG

ATGACAACTTTGCTTCCATTGTCACTGGTGTGGAGGAAG - UNI31235 - GCCGCCTGATCTTTGACAACCTGAAGAAATCCATCGCCTACACTCTG

ACTAGCAACATCCCTGAGATCACACCCTTCCTGCTCTTCATCATGGCTAACATCCCACTGCCTCTTGGCACCATCACCATCCTCTGCATTGACCTGGGTA

CCGACATG - UNI31235 - GTCCCTGCAATCTCCCTGGCCTACGAGGCTGCCGAGAGCGACATCATGAAGAGGCAGCCCAGGAACCCACGCACAGAC

AAACTGGTCAACGAAAGGCTCATCAGCATGGCCTACGGGCAGATTG GGATGATCCAGGCCCTCGGTGGTTTCTTCTCCTACTTTGTCATCCTGGCAGAA

AATGGCTTCTTGCCCGGAAACCTGGTGGGCATCCGGCTCAACTGGGATGATCGCACTGTCAATGACCTAGAAGACAGTTATGGGCAGCAGTGG ACTTAT

GAGCAGAGGAAGGTGGTAGAGTTCACATGCCACACAGCCTTCTTTGTGAGTATCGTGGTGGTCCAGTGGGCTGACCTGATCATCTGCAAGACCAGGAGGA

ACTCCGTCTTCCAGCAGGGCATGAA GAATAAGATCTTGATCTTCGGCTTGTTTGAGGAGACGGCCCTCGCTGCCTTCCTGTCCTACTGCCCAGGCATGG

ATGTGGCCCTTCGCATGTACCCTCTCAA GCCCAGCTGGTGGTTCTGTGCCTTCCCCTACAGTTTCCTCATCTTCGTCTATGATGAGATTCGCAAACTCA

TCCTGCGCAGGAACCCCGGGGGTGAGGGCCGCATGGCCAGGGGTAAAGGCTGGGAGGGGAAGCAGAGGGTGAGCACTCCCTGTGCCTCTCAGATGTGTCC

GTTCTTCTTTCTCTTCCCTCTCTCCCCGCCTTGCCTTTCACTCTCTTTCCAAGTGCGACTGTGTGTCTGAAAATAGGTTCTCCTTATGTAGCTCAGGCTG

CCCTTGAGCTCATGTCCCTGAGTTTCTCAGTGCTGGGATGACAGGCCTGCCACCACACCTTGTGTTTGTGTCAATGTTTCTTTCTGTGTCCCTGTCTCTT

GCTCATATGGCTCTCGTGTCTGCCTTCCTCTCACTTTGACTCTCTTCTGTCATTCCAGGTTGGGTGGAGAAAGAGACCTACTATTGACCTCAGCCACCAC

CACGTCGCCCGTGTCTTCCCTACCCCAAGCCCAGGACAGCCCTCTCCGGTCCCCCCATTTTGTACTCTGGGGGGAGGGGCCTTCTCTCCCCATGGCCCCC

CTCTCTCCTTGTGGCCCAGCCTCCTCTCCCACACCTCGATTACCTCCCACGTTCCCTCACTTCTTCCTCTGGCTGGCTTCTCTCCCCCCACAGCCCCTGC

CTCTCTTCTCCCTCTCTCTTCTGTGTCTCTCCCCCTCTCTCCCTTGCAACTCTGCCTCTCATTTCCTCCCTGGGCTCTTTTTTACTCCCCTGGGCCCCGT

CTCCTGGCGTATGCCATCTCCGGTTCTAATTCTGAACAATTATCAAATATATCAGTGGGGAG
Translation
MG DKKDDKSSPKKSKAKERRDLDDLKKEVAM TEHKMSVEEVCRKYNTDCVQ - UNI28994 - GLTHSKAQEILARDGPNALTPPPTTPEWVKFCR

QLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDN LYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQ QALVIREGEKMQVNAEEVVVGDLVE

IKGGDRVPADLRIISAHGCK VDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEG GTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIE

HFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVT VCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTV

AHMWFDNQIHEADTTEDQSG GTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLK RDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNST

NKYQ LSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLG GFCHYYLPEEQFPKGFAFDCDDVNFTTDN

LCFVGLMSMIDPPRAAVPDAVGKCRSAGIK VIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPR RDAKACVIHGTDLKDFTSEQID

EILQNHTEIVFARTSPQQKLIIVEGCQRQ - UNI31235 - GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEG

 - UNI31235 - GRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDM - UNI31235 - VPAISLAYEAAESDIMKRQP

RNPRTDKLVNERLISMAYGQIG GMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQW TYEQRKVVEFTCHTAFFVSIVVVQWAD

LIICKTRRNSVFQQGMK KNKILIFGLFEETALAAFLSYCPGMDVALRMYPLK KPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGEGRMARGKGWEGKQ

RVSTPCASQMCPFFFLFPLSPPCLSLSFQVRLCV
Transcript ENSMUST00000080882
Sequence
CACGGACCGACAGACGCACGCTCCCACCGCGGCGCGGGCGCTGCAGAGGCCCCCAGCCCGAGCCCGCGCCTGAGCCCATCCTGCGGCCACCGCTCATCAG

TCTGAACGCCGCTCTTCCCGCGGAGCCGCCAAGATGGGG GACAAAAAAGATGACAAGAGCTCGCCCAAGAAGAGCAAGGCCAAAGAGCGCCGGGACCTG

GATGACCTCAAGAAGGAAGTGGCTATG ACAGAGCACAAGATGTCAGTAGAAGAGGTCTGCCGGAAATACAATACTGACTGCGTGCAG - UNI28994 

- GGTCTGACACACAGTAAAGCCCAGGAGATCCTAGCCCGGGATGGGCCTAACGCCCTCACACCACCGCCCACCACCCCAGAATGGGTCAAGTTCTGCCG

GCAGCTGTTTGGTGGCTTCTCTATCCTGCTGTGGATCGGGGCAATCCTTTGCTTCCTGGCCTATGGCATCCAGGCAGGGACGGAGGATGACCCTTCCGGT

GACAAT CTGTACCTGGGCATAGTGCTGGCCGCAGTCGTGATCATCACCGGCTGCTTCTCCTACTACCAAGAAGCCAAGAGTTCTAAGATCATGGAGTCC

TTCAAGAACATGGTCCCCCAG CAAGCCCTTGTGATCCGGGAAGGTGAAAAGATGCAGGTGAATGCGGAGGAGGTGGTGGTCGGGGACCTGGTGGAGATC

AAGGGTGGTGACCGGGTGCCAGCTGACCTGCGCATCATCTCGGCCCATGGCTGCAAG GTGGACAACTCCTCCCTGACTGGCGAATCTGAGCCTCAGACC

CGCTCCCCGGACTGCACACACGACAACCCCCTGGAGACTCGGAACATCACCTTCTTTTCCACCAACTGCGTGGAAG GCACCGCTCGGGGTGTGGTGGTA

GCCACAGGTGACCGCACCGTCATGGGCCGCATTGCCACCCTGGCCTCGGGCTTGGAGGTGGGCAAGACGCCCATCGCCATTGAGATTGAGCATTTCATCC

AGCTCATTACGGGCGTGGCCGTGTTCCTGGGCGTGTCCTTCTTCATCCTCTCTCTCATTCTGGGTTACACCTGGCTCGAGGCAGTCATCTTCCTCATCGG

CATCATTGTGGCCAATGTCCCAGAGGGGCTGCTGGCTACTGTCACG GTGTGTCTGACGCTGACCGCCAAGCGCATGGCTCGCAAGAACTGCCTGGTGAA

GAACCTGGAGGCGGTGGAGACGCTGGGCTCCACGTCCACCATCTGCTCGGACAAGACCGGCACTCTCACCCAGAACCGCATGACCGTCGCCCACATGTGG

TTTGACAACCAGATCCACGAGGCAGACACCACAGAGGATCAGTCAG GGACCTCTTTCGACAAGAGCTCACACACCTGGGTGGCCCTGTCCCACATCGCC

GGGCTCTGCAACCGGGCCGTCTTCAAGGGCGGGCAGGACAACATCCCAGTACTCAAG AGGGACGTGGCCGGTGATGCCTCCGAGTCTGCCCTGCTTAAG

TGCATTGAGCTGTCCTCGGGTTCCGTAAAGCTGATGCGAGAACGGAACAAGAAAGTGGCTGAGATTCCGTTCAACTCGACCAACAAATACCAG CTATCC

ATCCATGAGACTGAGGATCCCAATGACAACCGGTACCTGCTAGTGATGAAGGGCGCCCCCGAACGCATTCTGGACCGCTGTGCCACCATCCTCCTGCAGG

GCAAGGAGCAGCCTCTGGATGAGGAGATGAAGGAGGCCTTCCAGAATGCCTACCTGGAGCTTGGTGGCCTGGGCGAGCGTGTGCTGG GTTTCTGCCATT

ACTACCTGCCTGAGGAACAGTTCCCCAAGGGCTTTGCCTTTGACTGTGATGACGTGAACTTCACCACAGACAACCTTTGCTTTGTGGGTCTCATGTCCAT

GATTGACCCTCCCCGGGCAGCCGTCCCTGACGCTGTGGGCAAATGCCGAAGCGCAGGCATCAAG GTCATCATGGTCACCGGCGATCACCCCATCACTGC

CAAGGCCATTGCCAAGGGTGTGGGTATCATCTCTGAGGGTAACGAGACTGTCGAAGACATCGCTGCCCGGCTCAACATCCCTGTCAGCCAGGTGAACCCC

AG GGATGCCAAAGCCTGTGTGATTCACGGCACCGACCTCAAGGACTTCACCTCGGAGCAGATTGACGAGATTCTGCAGAACCACACCGAGATCGTCTTT

GCCCGAACCTCCCCTCAGCAGAAGCTCATCATCGTGGAGGGCTGTCAGAGACAG - UNI31235 - GGAGCAATTGTGGCTGTGACTGGCGATGGTGT

GAATGACTCCCCTGCTCTGAAGAAGGCTGACATCGGGGTGGCCATGGGCATTGCTGGCTCTGATGTCTCTAAGCAGGCTGCCGACATGATTCTGCTGGAT

GACAACTTTGCTTCCATTGTCACTGGTGTGGAGGAAG - UNI31235 - GCCGCCTGATCTTTGACAACCTGAAGAAATCCATCGCCTACACTCTGAC

TAGCAACATCCCTGAGATCACACCCTTCCTGCTCTTCATCATGGCTAACATCCCACTGCCTCTTGGCACCATCACCATCCTCTGCATTGACCTGGGTACC

GACATG - UNI31235 - GTCCCTGCAATCTCCCTGGCCTACGAGGCTGCCGAGAGCGACATCATGAAGAGGCAGCCCAGGAACCCACGCACAGACAA

ACTGGTCAACGAAAGGCTCATCAGCATGGCCTACGGGCAGATTG GGATGATCCAGGCCCTCGGTGGTTTCTTCTCCTACTTTGTCATCCTGGCAGAAAA

TGGCTTCTTGCCCGGAAACCTGGTGGGCATCCGGCTCAACTGGGATGATCGCACTGTCAATGACCTAGAAGACAGTTATGGGCAGCAGTGG ACTTATGA

GCAGAGGAAGGTGGTAGAGTTCACATGCCACACAGCCTTCTTTGTGAGTATCGTGGTGGTCCAGTGGGCTGACCTGATCATCTGCAAGACCAGGAGGAAC

TCCGTCTTCCAGCAGGGCATGAA GAATAAGATCTTGATCTTCGGCTTGTTTGAGGAGACGGCCCTCGCTGCCTTCCTGTCCTACTGCCCAGGCATGGAT

GTGGCCCTTCGCATGTACCCTCTCAA GCCCAGCTGGTGGTTCTGTGCCTTCCCCTACAGTTTCCTCATCTTCGTCTATGATGAGATTCGCAAACTCATC

CTGCGCAGGAACCCCGGGG GTTGGGTGGAGAAAGAGACCTACTATTGACCTCAGCCACCACCACGTCGCCCGTGTCTTCCCTACCCCAAGCCCAGGACA

GCCCTCTCCGGTCCCCCCATTTTGTACTCTGGGGGGAGGGGCCTTCTCTCCCCATGGCCCCCCTCTCTCCTTGTGGCCCAGCCTCCTCTCCCACACCTCG

ATTACCTCCCACGTTCCCTCACTTCTTCCTCTGGCTGGCTTCTCTCCCCCCACAGCCCCTGCCTCTCTTCTCCCTCTCTCTTCTGTGTCTCTCCCCCTCT

CTCCCTTGCAACTCTGCCTCTCATTTCCTCCCTGGGCTCTTTTTTACTCCCCTGGGCCCCGTCTCCTGGCGTATGCCATCTCCGGTTCTAATTCTGAACA

ATTATCAAATATATCAGTGGGGAG
Translation
MG DKKDDKSSPKKSKAKERRDLDDLKKEVAM TEHKMSVEEVCRKYNTDCVQ - UNI28994 - GLTHSKAQEILARDGPNALTPPPTTPEWVKFCR

QLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDN LYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQ QALVIREGEKMQVNAEEVVVGDLVE

IKGGDRVPADLRIISAHGCK VDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEG GTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIE

HFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVT VCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTV

AHMWFDNQIHEADTTEDQSG GTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLK RDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNST

NKYQ LSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLG GFCHYYLPEEQFPKGFAFDCDDVNFTTDN

LCFVGLMSMIDPPRAAVPDAVGKCRSAGIK VIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPR RDAKACVIHGTDLKDFTSEQID

EILQNHTEIVFARTSPQQKLIIVEGCQRQ - UNI31235 - GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEG

 - UNI31235 - GRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDM - UNI31235 - VPAISLAYEAAESDIMKRQP

RNPRTDKLVNERLISMAYGQIG GMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQW TYEQRKVVEFTCHTAFFVSIVVVQWAD

LIICKTRRNSVFQQGMK KNKILIFGLFEETALAAFLSYCPGMDVALRMYPLK KPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG GWVEKETYY

For any suggestions or comments, please send an email to unitrap@crg.es