Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040938 (Slc16a11)
Chromosomal location
Chr 11: 70027582 - 70029915 (+)
Description
solute carrier family 16 (monocarboxylic acid transporters), member 11 Gene [Source:MGI (curated);Acc:Slc16a11-003]
RefSeq_peptide
NP_694721.2 
UniGene
Mm.289238 Mm.467628 
MGI
MGI:2663709 
Uniprot/SWISSPROT
Q5NC32 
Uniprot/SPTREMBL
Q9JJC0 
Human Ortholog
ENSG00000174326 (SLC16A11)
Omim not available
UniTrap UNI34117
Vector Insertion
Chr 11: 70027767 - 70028003
Public Clones IST14532D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28850
Vector Insertion
Chr 11: 70028785 - 70029915
Public Clones not available
Private Clones OST17898 (lexicon) OST17261 (lexicon) OST5756 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000094055
Sequence
ATGACCCCCAAGCCGGCCGGACCCCCGGACGGGGGCTGGGGCTGGGTGGTGGCGGCCGCAGCATTCGCCGTGAACGGGCTCTCCTACGGGCTCTTACGCT

CCCTGGGCCTTGCCCTCCCCGACCTCGCGGAGCACTTTGAACGAAGCGCCCAGGACACTGCGTGGGTCAGCGCCCTGGCCTTGGCCGTGCAGCAGGCAGC

CA GCCCAGTGGGCAGCGCCCTGAGCACTCGCTGGGGGGCACGCCCCGTGGTGATGGTTGGGGGAGTCCTAACCTCGCTTGGCTTGGTCTTCTCGGCTTT

CGCCCGAAGCCTCCTGCACCTCTACCTCGGCCTGGGCCTCCTCGCTG - UNI28850 - GCTCTGGCTGGGCCCTGGTGTTTGCCCCAGCCCTGGGTA

CCCTCTCTCGGTACTTCTCCCGCCGTCGGGTCTTGGCGGTAGGGTTGGCGCTCACCGGTAATGGGGCATCCTCGCTGCTCCTGGCACCTGCCTTGCAGTT

CCTCCTTGATACTTTCGGCTGGCGGGGTGCCTTGCTCCTCCTTGGCGCTGTCACCCTTCACCTCACACCCTGTGGCGCCTTGCTAAGACCTTTAGCTCTC

TCTGGTGACCCGCTGGCCCCACCTCGCACCCCCCTAGCTGCCCTTGGCCTAGGTCTGTTCAAGCGCCGGGCCTTTTCAGTCTTTGCTTTGGGCACCGCCT

TGATCGGGGGCGGATACTTCGTCCCCTACGTTCATTTGGGTCCGCATGCTTTAGATCAAGGCATGGGTGGTTATGGGGCAGCGTTAGTGGTGGCTGTCGC

TGCAGTGGGAGATGCCTGTGCCCGATTGGCCAGCGGATGGCTGGCAGACCAGGGCTGGGTGCCCCTTCCGAGGCTTCTGGTGGTGTTTGGGTCTCTGACT

GGGTTAGGGGTACTAGCAATGGGACTAGTGCCCACTGTGGGGACAGAGGAGGGTTGGGGGGCTCCTCTGCTGGCCGCTGCTGGGGCCTATGGGCTGAGCG

CTGGGAGTTATGCCCCACTGGTTTTCGGTGTGCTCCCGGGGCTGGTGGGCATTGGAGGTGTGGTGCAGGCCACAGGGCTGGTGATGATGCTGATGAGCCT

CGGGGGACTCCTGGGCCCTCCTCTGTCAG - UNI28850 - GCTTCCTAAGGGATAAGACAGGAGACTTCAGTGCCTCTTTCCTGGTGTGCAGCTCTT

TCATCCTCTCTGGCAGTTTCATCTACATGGGGCTGCCCAGAGCCCTCCCCTCCTGCCGTCCAGCCTCACCTCCAGCAACCCCTCCACCAGAGAGAGGGGA

GCTGCTCCCAGTTCCACAAGTCTCCCTGCTTTCCGCAGGGGGTACTGGCTCCATCCGGGATACCACTTGTTGATCATTTTCTTGGTTGACCTCCTTCCCT

AATAAAGAATTTTTATCTT
Translation
MTPKPAGPPDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFERSAQDTAWVSALALAVQQAAS SPVGSALSTRWGARPVVMVGGVLTSLGLVFS

AFARSLLHLYLGLGLLAG - UNI28850 - GSGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHL

TPCGALLRPLALSGDPLAPPRTPLAALGLGLFKRRAFSVFALGTALIGGGYFVPYVHLGPHALDQGMGGYGAALVVAVAAVGDACARLASGWLADQGWVP

LPRLLVVFGSLTGLGVLAMGLVPTVGTEEGWGAPLLAAAGAYGLSAGSYAPLVFGVLPGLVGIGGVVQATGLVMMLMSLGGLLGPPLSG - UNI28850

 - GFLRDKTGDFSASFLVCSSFILSGSFIYMGLPRALPSCRPASPPATPPPERGELLPVPQVSLLSAGGTGSIRDTTC
Transcript ENSMUST00000040733
Sequence
CCCAAGCCGGCCGGACCCCCGGACGGGGGCTGGGGCTGGGTGGTGGCGGCCGCAGCATTCGCCGTGAACGGGCTCTCCTACGGGCTCTTACGCTCCCTGG

GCCTTGCCCTCCCCGACCTCGCGGAGCACTTTGAACGAAGCGCCCAGGACACTGCGTGGGTCAGCGCCCTGGCCTTGGCCGTGCAGCAGGCAGCCA - U

NI28850 - GCTCTGGCTGGGCCCTGGTGTTTGCCCCAGCCCTGGGTACCCTCTCTCGGTACTTCTCCCGCCGTCGGGTCTTGGCGGTAGGGTTGGCGC

TCACCGGTAATGGGGCATCCTCGCTGCTCCTGGCACCTGCCTTGCAGTTCCTCCTTGATACTTTCGGCTGGCGGGGTGCCTTGCTCCTCCTTGGCGCTGT

CACCCTTCACCTCACACCCTGTGGCGCCTTGCTAAGACCTTTAGCTCTCTCTGGTGACCCGCTGGCCCCACCTCGCACCCCCCTAGCTGCCCTTGGCCTA

GGTCTGTTCAAGCGCCGGGCCTTTTCAGTCTTTGCTTTGGGCACCGCCTTGATCGGGGGCGGATACTTCGTCCCCTACGTTCATTTGGGTCCGCATGCTT

TAGATCAAGGCATGGGTGGTTATGGGGCAGCGTTAGTGGTGGCTGTCGCTGCAGTGGGAGATGCCTGTGCCCGATTGGCCAGCGGATGGCTGGCAGACCA

GGGCTGGGTGCCCCTTCCGAGGCTTCTGGTGGTGTTTGGGTCTCTGACTGGGTTAGGGGTACTAGCAATGGGACTAGTGCCCACTGTGGGGACAGAGGAG

GGTTGGGGGGCTCCTCTGCTGGCCGCTGCTGGGGCCTATGGGCTGAGCGCTGGGAGTTATGCCCCACTGGTTTTCGGTGTGCTCCCGGGGCTGGTGGGCA

TTGGAGGTGTGGTGCAGGCCACAGGGCTGGTGATGATGCTGATGAGCCTCGGGGGACTCCTGGGCCCTCCTCTGTCAGGTAAGGGCTGAGCTCGCGGATT

CGCTCACGACTCTCTTCTGCCCCTGAGATGCCAAGCTTCTAAATTCCTTTCCCCTCTTCTCAGGCTTCCTAAGGGATAAGACAGGAGACTTCAGTGCCTC

TTTCCTGGTGTGCAGCTCTTTCATCCTCTCTGGCAGTTTCATCTACATGGGGCTGCCCAGAGCCCTCCCCTCCTGCCGTCCAGCCTCACCTCCAGCAACC

CCTCCACCAGAGAGAGGGGAGCTGCTCCCAGTTCCACAAGTCTCCCTGCTTTCCGCAGGGGGTACTGGCTCCATCCGGGATACCACTTGTTGATCATTTT

CTTGGTTGACCTCCTTCCCTAATAAAGAATTTTTATCTTA
Translation
PKPAGPPDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFERSAQDTAWVSALALAVQQAAS - UNI28850 - SSGWALVFAPALGT
Transcript ENSMUST00000069008
Sequence
ACCCCGTGTCCCAGGTGGCTTGGGCCCCTGTGGTGATCTCTGTTTACTGGAGAGAGCGGTCCAAGTTGGGCTCCATCTCTGTGCTGGCTAGCTGCTCCGC

AGAACCCTTTCTGCGGAAAGCGCGGAGAAAATCCGGCCGAACCCACCTTCGCCCTTTCCCTACCCCCAACGCCGGGAGAGGTCGG - UNI34117 - C

AGACGGCGATGACCCCCAAGCCGGCCGGACCCCCGGACGGGGGCTGGGGCTGGGTGGTGGCGGCCGCAGCATTCGCCGTGAACGGGCTCTCCTACGGGCT

CTTACGCTCCCTGGGCCTTGCCCTCCCCGACCTCGCGGAGCACTTTGAACGAAGCGCCCAGGACACTGCGTGG GCCCAGTGGGCAGCGCCCTGAGCACT

CGCTGGGGGGCACGCCCCGTGGTGATGGTTGGGGGAGTCCTAACCTCGCTTGGCTTGGTCTTCTCGGCTTTCGCCCGAAGCCTCCTGCACCTCTACCTCG

GCCTGGGCCTCCTCGCTG - UNI28850 - GCTCTGGCTGGGCCCTGGTGTTTGCCCCAGCCCTGGGTACCCTCTCTCGGTACTTCTCCCGCCGTCGG

GTCTTGGCGGTAGGGTTGGCGCTCACCGGTAATGGGGCATCCTCGCTGCTCCTGGCACCTGCCTTGCAGTTCCTCCTTGATACTTTCGGCTGGCGGGGTG

CCTTGCTCCTCCTTGGCGCTGTCACCCTTCACCTCACACCCTGTGGCGCCTTGCTAAGACCTTTAGCTCTCTCTGGTGACCCGCTGGCCCCACCTCGCAC

CCCCCTAGCTGCCCTTGGCCTAGGTCTGTTCAAGCGCCGGGCCTTTTCAGTCTTTGCTTTGGGCACCGCCTTGATCGGGGGCGGATACTTCGTCCCCTAC

GTTCATTTGGGTCCGCATGCTTTAGATCAAGGCATGGGTGGTTATGGGGCAGCGTTAGTGGTGGCTGTCGCTGCAGTGGGAGATGCCTGTGCCCGATTGG

CCAGCGGATGGCTGGCAGACCAGGGCTGGGTGCCCCTTCCGAGGCTTCTGGTGGTGTTTGGGTCTCTGACTGGGTTAGGGGTACTAGCAATGGGACTAGT

GCCCACTGTGGGGACAGAGGAGGGTTGGGGGGCTCCTCTGCTGGCCGCTGCTGGGGCCTATGGGCTGAGCGCTGGGAGTTATGCCCCACTGGTTTTCGGT

GTGCTCCCGGGGCTGGTGGGCATTGGAGGTGTGGTGCAGGCCACAGGGCTGGTGATGATGCTGATGAGCCTCGGGGGACTCCTGGGCCCTCCTCTGTCAG

GTAAGGGCTGAGCTCGCGGATTCGCTCACGACTCTCTTCTGCCCCTGAGATGCCAAGCTTCTAAATTCCTTTCCCCTCTTCTCAGGCTTCCTAAGGGATA

AGACAGGAGACTTCAGTGCCTCTTTCCTGGTGTGCAGCTCTTTCATCCTCTCTGGCAGTTTCATCTACATGGGGCTGCCCAGAGCCCTCCCCTCCTGCCG

TCCAGCCTCACCTCCAGCAACCCCTCCACCAGAGAGAGGGGAGCTGCTCCCAGTTCCACAAGTCTCCCTGCTTTCCGCAGGGGGTACTGGCTCCATCCGG

GATACCACTTGTTGATCATTTTCTTGGTTGACCTCCTTCCCTAATAAAGAATTTTTATCTTA
Translation
 - UNI34117 -  MVGGVLTSLGLVFSAFARSLLHLYLGLGLLAG - UNI28850 - GSGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSL

LLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRPLALSGDPLAPPRTPLAALGLGLFKRRAFSVFALGTALIGGGYFVPYVHLGPHALDQGMGGYG

AALVVAVAAVGDACARLASGWLADQGWVPLPRLLVVFGSLTGLGVLAMGLVPTVGTEEGWGAPLLAAAGAYGLSAGSYAPLVFGVLPGLVGIGGVVQATG

LVMMLMSLGGLLGPPLSGKG

For any suggestions or comments, please send an email to unitrap@crg.es