Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040940 (Arhgef1)
Chromosomal location
Chr 7: 25687931 - 25711611 (+)
Description
Rho guanine nucleotide exchange factor (GEF) 1 Gene [Source:MGI (curated);Acc:Arhgef1-002]
RefSeq_peptide
NP_001123624.1 NP_001123625.1 NP_032514.1 NP_001123623.1 NP_001123622.1 
UniGene
Mm.407747 Mm.3181 
MGI
MGI:1353510 
Uniprot/SWISSPROT
Q61210 
Uniprot/SPTREMBL
Q6KAM6 
Human Ortholog
ENSG00000076928 (ARHGEF1)
Omim not available
UniTrap UNI7818
Vector Insertion
Chr 7: 25689517 - 25692734
Public Clones RRN400 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20795
Vector Insertion
Chr 7: 25693444 - 25697075
Public Clones not available
Private Clones OST352102 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29342
Vector Insertion
Chr 7: 25704796 - 25706889
Public Clones PSTVU01.HE8Q (vanderbilt) IST11189B8 (tigm) IST14854B11 (tigm) IST13890C10 (tigm)
IST10513B2 (tigm) IST12053F12 (tigm) IST14406G11 (tigm) IST14405A1 (tigm)
IST11814E7 (tigm) IST12058F7 (tigm) IST12267F3 (tigm) IST13248H7 (tigm)
IST14280C1 (tigm) IST13136H10 (tigm) IST14312E6 (tigm) IST12654G1 (tigm)
IST13978F2 (tigm) IST13795F1 (tigm) IST12314B9 (tigm) IST14379C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15697
Vector Insertion
Chr 7: 25710339 - 25710419
Public Clones PST3675-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108423
Sequence
AGAGCCAGGAAGCCGGAGTCGGGACACCGGGCCCGGGATCCCCGAGCCCGACCTCGGGCGCCTCGCCGGTCACCTCCCCGCGCGGACACCAG - UNI78

18 - CCCGGCGGAGTCCTGGAGATGGGAGAAGTCGCCGGAGGGGCG GCCCCAGGGCCTCCCCGGTCTGGCCTGGTGTCCATCATCATCGGGGCGGAGG

ATGAGGATTTTGAGAACGAGCTGGAGGCG AACTCAGAAGATCAAAACAGCCAGTTCCAGAGCCTAGAGCAAGTGAAGCGCCGCCCTGCCCACCTCATGG

CCCTCCTGCAGCATGTGGCCCTGCAGTTCGAGCCAGGACCACTG - UNI20795 - CTCTGCTGCCTGCATGCAGACATGCTGAGCTCTCTGGGCCCC

AAAGAAGCCAAGAAGGCCTTCCTTGACTTCTATCACAGTTTCCTGGAGAAGACTGCG GTTCTACGGGTGCCGGTCCCTCCCAGTGTCGCTTTTGAACTT

G ATCGTACTCGACCTGATCTGATCTCTGAGGATGTCCAGAGGCGGTTCATACAAGAGGTGGTGCAGAGCCAGCAGGCAGCCGTGAGCCGTCAGCTAGAG

GACTTCCGCTCCAAGCGGCTCATGGGCATGACGCCCTGGGAGCAGGAACTGAGCCTGCTGGAGCCCTGGATTGGGAAAGACCGAGGCAACTATGAGGCCC

GGGAGCGGCATGTTGCGGAGCGGCTGCTGTCCCACCTGGAGGAGACCCA GCATACCATCTCTACAGATGAAGAGAAAAG TGCTGCTGTGGTCACTGCC

ATCAGCCTGTATATGCGCCACCTTGGAGTCCGGACCAAGAGTGGGGACAAGAAGTCGGGAAGGAACTTCTTCCGGAAAAAG GTGATGGGGAATCGGAGG

TCAGACGAACCCCCAAAGACAAAGAAAGGGCTGAGCAGTATCCTAGATCCTGCACGTTGGAACCGGGGAGAGCCATCCG CTCCAGATTGTCGACATCTA

AAGGTCGAGGCTGATG CAGAGAAGCCAGGCCCTGCAGACCGGAAGGGAGGCCTGGGTATGTCTTCTCGGGACAGGACTGTTGGGACTCCTGGACAGGAC

AACCCAGGAGTCTCCCTGCACCCTCTGTCTACAGACAGCGTCGACTCCCGGGAACCAG GCGTGGATACCCCGCAGGAGCCAGGGGATACACCCCCACAG

GGCCCTACCAGCCTGGAGCCCCTGGCGCCCCCAGAGAGCACAGAGGACAATGGCGAGACTGAGAG CCCTGAGCCCGGAGATGATGGGGAGCCAGGACGG

TCAGGCCTGGAACTGGAACCAGAAGAACCTCCTGGGTGGAGGGAACTCGTGCCCCCAGACACCCTGCTCAGTCTGCCCAAGAGCCAAGTGAAGCGGCAAG

AGGTCATCAGCG - UNI29342 - AGCTGCTCGTGACTGAGGCAGCTCACGTGCGCATGCTACGGGTACTGCATGACCTCTTCTACCAGCCCATGGCG

GATGGAGGCTTCTTCCCTCTGGACGAGCTGCAGAACATCTTCCCGAGCCTGGATGAGCTCATCGAGGTGCACT CCCTGTTCCTCGATCGCTTGATGAAG

CGGAGACAAGAGAGTGGCTACCTCATTGAGGAGATCGGCGATGTGCTACTGGCCCGG TTCGATGGTGCTGAGGGCTCATGGTTCCAGAAGATCTCCTCC

CGCTTCTGCAGCCGCCAGTCGTTCGCTCTAGAGCAGCTCAAAGCCAAGCAGCGCAAGGAGCCTCGGTTCTGTGCCTTTGTGCAG GAAGCTGAGAGCCGC

CCGAGATGCCGGCGCCTACAGTTAAAGGACATGATCCCCACTGAGATGCAGCGACTGACCAAGTACCCACTGCTGCTACAGAGCATCGGGCAGAACACAG

 AGGAGTCTACAGAACGAGGGAAAGTGGAGCTTGCAGCTGAGTGCTGCCGGGAGATTCTGCACCATGTCAATCAAGCCGTCCGTGACATGGAGGACCTGC

TG CGGCTCAAGGATTACCAGCGGCGCCTGGACTTGACTCACCTACGGCAGAGCAGTGACCCTATGCTGAGCGAGTTCAAG AACCTGGACATCACTAAG

AAGAAGTTGGTCCATGAAGGCCCCCTCACGTGGCGAGTGACCAAAGACAAAGCTATAG AAGTGCACGTGCTCTTGCTGGACGACCTGCTGCTGCTGCTC

CAGCGCCAGGACGAGAGGCTGCTGCTCAAGTCCCACAGCCGGACGCTGACACCTACCCCCGATGGCAAGACCATGCTGCGGCCGGTGCTCCGGCTCACCT

CTGCCATGACCCGAGAGGTGGCCACTG ATCACAAAGCTTTCTACGTCATTTTTACCTGGGACCAGGAGGCCCAGATATATGAGCTGGTGGCACAGACAT

CTTCGGAACGCAAAAA CTGGTGTAACCTCATCACTGAGACTGCTGGATCCCTGAAGGTCCCTGCCCCTGCCTCCCGCCTCAAACCCCGGCCCAGCCCAA

GCAG CATCCGAGAACCCCTGCTCAGCAGCTCTGAGAATGGCACTGGAGGCGCAGAGATGGCTCCAGCTGATG - UNI15697 - CCAGGACAGAGCG

GCTCCTCAATGACCTCCTGCCCTTCTGCAGACCAGGCCCAGAGGGCCAGCTTGCTGCCACAGCCCTTCAGAAAG GAGTTGGAAGAGGAATTTTGTCGCC

TAAGACCCCTCCTGTCCCAGCTTGGGGGGACTCTGTCCCCCAACCTGGCTGCACCTGAACGCTCTGCTCAGACAG GCCTTTCATGAAGAGAAGAGTGGG

GGAGAGGATGCAGGGGGGCCCACCCCCACCCCCACAGCTGCCACAGCATCTCACACCCCAGAGGCCTGGAGCAGAGGGAGATTGGCTGAACTTGATAGCA

GACCTGCTCGGGTCCCTGCCTCCCACTCTGGCCTCTGCCTTTCTCCCTCCTGCCTTCTGCTTGGGGAACTCAGGGCTTCACTCCCAGAGCACCCCCTTAA

TCCCCACTTTTCAGGCCGTCTCAGTATTGCCTATGGGGGGTCACCCTCCTTCCCCTACCCCAAGTGCCTTTGCTATGTTTTTATATCCTGGACTGGAGGT

TTATTTTTAATATATATTATCT
Translation
 - UNI7818 - MGEVAGGA APGPPRSGLVSIIIGAEDEDFENELEA NSEDQNSQFQSLEQVKRRPAHLMALLQHVALQFEPGPL - UNI20795 

- LCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTA VLRVPVPPSVAFELD DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQ

ELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQ QHTISTDEEKS SAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRKK VMGNRRSDEPPKTKKGL

SSILDPARWNRGEPSA APDCRHLKVEADA AEKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPG GVDTPQEPGDTPPQGPTSLE

PLAPPESTEDNGETES SPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVISE - UNI29342 - ELLVTEAAHVRMLRVLHDL

FYQPMADGGFFPLDELQNIFPSLDELIEVHS SLFLDRLMKRRQESGYLIEEIGDVLLAR FDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCA

FVQ EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTE EESTERGKVELAAECCREILHHVNQAVRDMEDLL RLKDYQRRLDLTHLRQSSDPM

LSEFK NLDITKKKLVHEGPLTWRVTKDKAIE EVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD DHKAFYVIF

TWDQEAQIYELVAQTSSERKN NWCNLITETAGSLKVPAPASRLKPRPSPSS SIREPLLSSSENGTGGAEMAPADA - UNI15697 - ARTERLLND

LLPFCRPGPEGQLAATALQKG GVGRGILSPKTPPVPAWGDSVPQPGCT 
Transcript ENSMUST00000117419
Sequence
CTCTGCGGCACGGGTGGGGGAACCTGGAGCTCGAGCGCGGAGGCTTCGGTTCCTGAGGCTGCAGTGGCTTGCTTCTCTTCCCATCCGACAG - UNI781

8 - CCCGGCGGAGTCCTGGAGATGGGAGAAGTCGCCGGAGGGGCG GCCCCAGGGCCTCCCCGGTCTGGCCTGGTGTCCATCATCATCGGGGCGGAGGA

TGAGGATTTTGAGAACGAGCTGGAGGCG AACTCAGAAGATCAAAACAGCCAGTTCCAGAGCCTAGAGCAAGTGAAGCGCCGCCCTGCCCACCTCATGGC

CCTCCTGCAGCATGTGGCCCTGCAGTTCGAGCCAGGACCACTG - UNI20795 - CTCTGCTGCCTGCATGCAGACATGCTGAGCTCTCTGGGCCCCA

AAGAAGCCAAGAAGGCCTTCCTTGACTTCTATCACAGTTTCCTGGAGAAGACTGCG GTTCTACGGGTGCCGGTCCCTCCCAGTGTCGCTTTTGAACTTG

 ATCGTACTCGACCTGATCTGATCTCTGAGGATGTCCAGAGGCGGTTCATACAAGAGGTGGTGCAGAGCCAGCAGGCAGCCGTGAGCCGTCAGCTAGAGG

ACTTCCGCTCCAAGCGGCTCATGGGCATGACGCCCTGGGAGCAGGAACTGAGCCTGCTGGAGCCCTGGATTGGGAAAGACCGAGGCAACTATGAGGCCCG

GGAGCGGCATGTTGCGGAGCGGCTGCTGTCCCACCTGGAGGAGACCCA GCATACCATCTCTACAGATGAAGAGAAAAG TGCTGCTGTGGTCACTGCCA

TCAGCCTGTATATGCGCCACCTTGGAGTCCGGACCAAGAGTGGGGACAAGAAGTCGGGAAGGAACTTCTTCCGGAAAAAG GTGATGGGGAATCGGAGGT

CAGACGAACCCCCAAAGACAAAGAAAGGGCTGAGCAGTATCCTAGATCCTGCACGTTGGAACCGGGGAGAGCCATCCG CTCCAGATTGTCGACATCTAA

AGGTCGAGGCTGATG CAGAGAAGCCAGGCCCTGCAGACCGGAAGGGAGGCCTGGGTATGTCTTCTCGGGACAGGACTGTTGGGACTCCTGGACAGGACA

ACCCAGGAGTCTCCCTGCACCCTCTGTCTACAGACAGCGTCGACTCCCGGGAACCAG GCGTGGATACCCCGCAGGAGCCAGGGGATACACCCCCACAGG

GCCCTACCAGCCTGGAGCCCCTGGCGCCCCCAGAGAGCACAGAGGACAATGGCGAGACTGAGAG CCCTGAGCCCGGAGATGATGGGGAGCCAGGACGGT

CAGGCCTGGAACTGGAACCAGAAGAACCTCCTGGGTGGAGGGAACTCGTGCCCCCAGACACCCTGCTCAGTCTGCCCAAGAGCCAAGTGAAGCGGCAAGA

GGTCATCAGCG - UNI29342 - AGCTGCTCGTGACTGAGGCAGCTCACGTGCGCATGCTACGGGTACTGCATGACCTCTTCTACCAGCCCATGGCGG

ATGGAGGCTTCTTCCCTCTGGACGAGCTGCAGAACATCTTCCCGAGCCTGGATGAGCTCATCGAGGTGCACT CCCTGTTCCTCGATCGCTTGATGAAGC

GGAGACAAGAGAGTGGCTACCTCATTGAGGAGATCGGCGATGTGCTACTGGCCCGG TTCGATGGTGCTGAGGGCTCATGGTTCCAGAAGATCTCCTCCC

GCTTCTGCAGCCGCCAGTCGTTCGCTCTAGAGCAGCTCAAAGCCAAGCAGCGCAAGGAGCCTCGGTTCTGTGCCTTTGTGCAG GAAGCTGAGAGCCGCC

CGAGATGCCGGCGCCTACAGTTAAAGGACATGATCCCCACTGAGATGCAGCGACTGACCAAGTACCCACTGCTGCTACAGAGCATCGGGCAGAACACAG 

AGGAGTCTACAGAACGAGGGAAAGTGGAGCTTGCAGCTGAGTGCTGCCGGGAGATTCTGCACCATGTCAATCAAGCCGTCCGTGACATGGAGGACCTGCT

G CGGCTCAAGGATTACCAGCGGCGCCTGGACTTGACTCACCTACGGCAGAGCAGTGACCCTATGCTGAGCGAGTTCAAG AACCTGGACATCACTAAGA

AGAAGTTGGTCCATGAAGGCCCCCTCACGTGGCGAGTGACCAAAGACAAAGCTATAG AAGTGCACGTGCTCTTGCTGGACGACCTGCTGCTGCTGCTCC

AGCGCCAGGACGAGAGGCTGCTGCTCAAGTCCCACAGCCGGACGCTGACACCTACCCCCGATGGCAAGACCATGCTGCGGCCGGTGCTCCGGCTCACCTC

TGCCATGACCCGAGAGGTGGCCACTG ATCACAAAGCTTTCTACGTCATTTTTACCTGGGACCAGGAGGCCCAGATATATGAGCTGGTGGCACAGACATC

TTCGGAACGCAAAAA CTGGTGTAACCTCATCACTGAGACTGCTGGATCCCTGAAGGTCCCTGCCCCTGCCTCCCGCCTCAAACCCCGGCCCAGCCCAAG

CAG CATCCGAGAACCCCTGCTCAGCAGCTCTGAGAATGGCACTGGAGGCGCAGAGATGGCTCCAGCTGATG - UNI15697 - CCAGGACAGAGCGG

CTCCTCAATGACCTCCTGCCCTTCTGCAGACCAGGCCCAGAGGGCCAGCTTGCTGCCACAGCCCTTCAGAAAG TACTGTCCCTGAAGCAGATCCTGCTA

AGCACTGAGGAAGACAGTGGAGCGGGGCCTCCCCGCGATGGGGATGGGGTGCCTGGTGGTAGGGCCCCCGGCCCAGTGCACACCCAGGAGATTGAGGAAA

ACTTGCTTAGCTTAGAGGTGGCCATCAGACAACTGGAG GAGTTGGAAGAGGAATTTTGTCGCCTAAGACCCCTCCTGTCCCAGCTTGGGGGGACTCTGT

CCCCCAACCTGGCTGCACCTGAACGCTCTGCTCAGACAG GCCTTTCATGAAGAGAAGAGTGGGGGAGAGGATGCAGGGGGGCCCACCCCCACCCCCACA

GCTGCCACAGCATCTCACACCCCAGAGGCCTGGAGCAGAGGGAGATTGGCTGAACTTGATAGCAGACCTGCTCGGGTCCCTGCCTCCCACTCTGGCCTCT

GCCTTTCTCCCTCCTGCCTTCTGCTTGGGGAACTCAGGGCTTCACTCCCAGAGCACCCCCTTAATCCCCACTTTTCAGGCCGTCTCAGTATTGCCTATGG

GGGGTCACCCTCCTTCCCCTACCCCAAGTGCCTTTGCTATGTTTTTATATCCTGGACTGGAGGTTTATTTTTAATATATATTATCTAAGGAAA
Translation
 - UNI7818 - MGEVAGGA APGPPRSGLVSIIIGAEDEDFENELEA NSEDQNSQFQSLEQVKRRPAHLMALLQHVALQFEPGPL - UNI20795 

- LCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTA VLRVPVPPSVAFELD DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQ

ELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQ QHTISTDEEKS SAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRKK VMGNRRSDEPPKTKKGL

SSILDPARWNRGEPSA APDCRHLKVEADA AEKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPG GVDTPQEPGDTPPQGPTSLE

PLAPPESTEDNGETES SPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVISE - UNI29342 - ELLVTEAAHVRMLRVLHDL

FYQPMADGGFFPLDELQNIFPSLDELIEVHS SLFLDRLMKRRQESGYLIEEIGDVLLAR FDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCA

FVQ EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTE EESTERGKVELAAECCREILHHVNQAVRDMEDLL RLKDYQRRLDLTHLRQSSDPM

LSEFK NLDITKKKLVHEGPLTWRVTKDKAIE EVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD DHKAFYVIF

TWDQEAQIYELVAQTSSERKN NWCNLITETAGSLKVPAPASRLKPRPSPSS SIREPLLSSSENGTGGAEMAPADA - UNI15697 - ARTERLLND

LLPFCRPGPEGQLAATALQKV VLSLKQILLSTEEDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLE ELEEEFCRLRPLLSQLGGTLSP

NLAAPERSAQTG GLS
Transcript ENSMUST00000117796
Sequence
GGAGCCGCGCGGGCGGCGAGAAGGGGAAGGAAGCCGAGGTGCCGGGCGGGCACGGGGCGCGGGCAGGAAGCGGGGAGGGGCGGCGGGCGGGGGCTCCGGA

AAAACGCCCCGACTTCCTGCCCGCCAGAGCCAGGAAGCCGGAGTCGGGACACCGGGCCCGGGATCCCCGAGCCCGACCTCGGGCGCCTCGCCGGTCACCT

CCCCGCGCGGACACCAG - UNI7818 - CCCGGCGGAGTCCTGGAGATGGGAGAAGTCGCCGGAGGGGCG GCCCCAGGGCCTCCCCGGTCTGGCCTG

GTGTCCATCATCATCGGGGCGGAGGATGAGGATTTTGAGAACGAGCTGGAGGCG AACTCAGAAGATCAAAACAGCCAGTTCCAGAGCCTAGAGCAAGTG

AAGCGCCGCCCTGCCCACCTCATGGCCCTCCTGCAGCATGTGGCCCTGCAGTTCGAGCCAGGACCACTG - UNI20795 - CTCTGCTGCCTGCATGC

AGACATGCTGAGCTCTCTGGGCCCCAAAGAAGCCAAGAAGGCCTTCCTTGACTTCTATCACAGTTTCCTGGAGAAGACTGCG GTTCTACGGGTGCCGGT

CCCTCCCAGTGTCGCTTTTGAACTTG ATCGTACTCGACCTGATCTGATCTCTGAGGATGTCCAGAGGCGGTTCATACAAGAGGTGGTGCAGAGCCAGCA

GGCAGCCGTGAGCCGTCAGCTAGAGGACTTCCGCTCCAAGCGGCTCATGGGCATGACGCCCTGGGAGCAGGAACTGAGCCTGCTGGAGCCCTGGATTGGG

AAAGACCGAGGCAACTATGAGGCCCGGGAGCGGCATGTTGCGGAGCGGCTGCTGTCCCACCTGGAGGAGACCCA GCATACCATCTCTACAGATGAAGAG

AAAAG TGCTGCTGTGGTCACTGCCATCAGCCTGTATATGCGCCACCTTGGAGTCCGGACCAAGAGTGGGGACAAGAAGTCGGGAAGGAACTTCTTCCGG

AAAAAG GTGATGGGGAATCGGAGGTCAGACGAACCCCCAAAGACAAAGAAAGGGCTGAGCAGTATCCTAGATCCTGCACGTTGGAACCGGGGAGAGCCA

TCCG CTCCAGATTGTCGACATCTAAAGGTCGAGGCTGATG CAGAGAAGCCAGGCCCTGCAGACCGGAAGGGAGGCCTGGGTATGTCTTCTCGGGACAG

GACTGTTGGGACTCCTGGACAGGACAACCCAGGAGTCTCCCTGCACCCTCTGTCTACAGACAGCGTCGACTCCCGGGAACCAG GCGTGGATACCCCGCA

GGAGCCAGGGGATACACCCCCACAGGGCCCTACCAGCCTGGAGCCCCTGGCGCCCCCAGAGAGCACAGAGGACAATGGCGAGACTGAGAG GCTATCAGG

GCGTCTAGGGCGCTCAGAGAGCCTGCGGGTGAGTGACCGCCGCCGGCCTTCCCGGGGCAGCCTCGGGGCTAAGGGCCGGGGTGGGGGCCGTTCCCGGAGC

GACGTGGACATGGACCCGGGCTCCGCCACGGCCGTGCTTGGCCCCACCCGACGAGCCAC CCCTGAGCCCGGAGATGATGGGGAGCCAGGACGGTCAGGC

CTGGAACTGGAACCAGAAGAACCTCCTGGGTGGAGGGAACTCGTGCCCCCAGACACCCTGCTCAGTCTGCCCAAGAGCCAAGTGAAGCGGCAAGAGGTCA

TCAGCG - UNI29342 - AGCTGCTCGTGACTGAGGCAGCTCACGTGCGCATGCTACGGGTACTGCATGACCTCTTCTACCAGCCCATGGCGGATGGA

GGCTTCTTCCCTCTGGACGAGCTGCAGAACATCTTCCCGAGCCTGGATGAGCTCATCGAGGTGCACT CCCTGTTCCTCGATCGCTTGATGAAGCGGAGA

CAAGAGAGTGGCTACCTCATTGAGGAGATCGGCGATGTGCTACTGGCCCGG TTCGATGGTGCTGAGGGCTCATGGTTCCAGAAGATCTCCTCCCGCTTC

TGCAGCCGCCAGTCGTTCGCTCTAGAGCAGCTCAAAGCCAAGCAGCGCAAGGAGCCTCGGTTCTGTGCCTTTGTGCAG GAAGCTGAGAGCCGCCCGAGA

TGCCGGCGCCTACAGTTAAAGGACATGATCCCCACTGAGATGCAGCGACTGACCAAGTACCCACTGCTGCTACAGAGCATCGGGCAGAACACAG AGGAG

TCTACAGAACGAGGGAAAGTGGAGCTTGCAGCTGAGTGCTGCCGGGAGATTCTGCACCATGTCAATCAAGCCGTCCGTGACATGGAGGACCTGCTG CGG

CTCAAGGATTACCAGCGGCGCCTGGACTTGACTCACCTACGGCAGAGCAGTGACCCTATGCTGAGCGAGTTCAAG AACCTGGACATCACTAAGAAGAAG

TTGGTCCATGAAGGCCCCCTCACGTGGCGAGTGACCAAAGACAAAGCTATAG AAGTGCACGTGCTCTTGCTGGACGACCTGCTGCTGCTGCTCCAGCGC

CAGGACGAGAGGCTGCTGCTCAAGTCCCACAGCCGGACGCTGACACCTACCCCCGATGGCAAGACCATGCTGCGGCCGGTGCTCCGGCTCACCTCTGCCA

TGACCCGAGAGGTGGCCACTG ATCACAAAGCTTTCTACGTCATTTTTACCTGGGACCAGGAGGCCCAGATATATGAGCTGGTGGCACAGACATCTTCGG

AACGCAAAAA CTGGTGTAACCTCATCACTGAGACTGCTGGATCCCTGAAGGTCCCTGCCCCTGCCTCCCGCCTCAAACCCCGGCCCAGCCCAAGCAG C

ATCCGAGAACCCCTGCTCAGCAGCTCTGAGAATGGCACTGGAGGCGCAGAGATGGCTCCAGCTGATG - UNI15697 - CCAGGACAGAGCGGCTCCT

CAATGACCTCCTGCCCTTCTGCAGACCAGGCCCAGAGGGCCAGCTTGCTGCCACAGCCCTTCAGAAAG TACTGTCCCTGAAGCAGATCCTGCTAAGCAC

TGAGGAAGACAGTGGAGCGGGGCCTCCCCGCGATGGGGATGGGGTGCCTGGTGGTAGGGCCCCCGGCCCAGTGCACACCCAGGAGATTGAGGAAAACTTG

CTTAGCTTAGAGGTGGCCATCAGACAACTGGAG GAGTTGGAAGAGGAATTTTGTCGCCTAAGACCCCTCCTGTCCCAGCTTGGGGGGACTCTGTCCCCC

AACCTGGCTGCACCTGAACGCTCTGCTCAGACAG GCCTTTCATGAAGAGAAGAGTGGGGGAGAGGATGCAGGGGGGCCCACCCCCACCCCCACAGCTGC

CACAGCATCTCACACCCCAGAGGCCTGGAGCAGAGGGAGATTGGCTGAACTTGATAGCAGACCTGCTCGGGTCCCTGCCTCCCACTCTGGCCTCTGCCTT

TCTCCCTCCTGCCTTCTGCTTGGGGAACTCAGGGCTTCACTCCCAGAGCACCCCCTTAATCCCCACTTTTCAGGCCGTCTCAGTATTGCCTATGGGGGGT

CACCCTCCTTCCCCTACCCCAAGTGCCTTTGCTATGTTTTTATATCCTGGACTGGAGGTTTATTTTTAATATATATTATCTAAGGAAA
Translation
 - UNI7818 - MGEVAGGA APGPPRSGLVSIIIGAEDEDFENELEA NSEDQNSQFQSLEQVKRRPAHLMALLQHVALQFEPGPL - UNI20795 

- LCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTA VLRVPVPPSVAFELD DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQ

ELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQ QHTISTDEEKS SAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRKK VMGNRRSDEPPKTKKGL

SSILDPARWNRGEPSA APDCRHLKVEADA AEKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPG GVDTPQEPGDTPPQGPTSLE

PLAPPESTEDNGETER RLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPGSATAVLGPTRRAT TPEPGDDGEPGRSGLELEPEEPPGW

RELVPPDTLLSLPKSQVKRQEVISE - UNI29342 - ELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHS SLFLDRLMKR

RQESGYLIEEIGDVLLAR FDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQ EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNT

E EESTERGKVELAAECCREILHHVNQAVRDMEDLL RLKDYQRRLDLTHLRQSSDPMLSEFK NLDITKKKLVHEGPLTWRVTKDKAIE EVHVLLLDD

LLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD DHKAFYVIFTWDQEAQIYELVAQTSSERKN NWCNLITETAGSLKVPAPAS

RLKPRPSPSS SIREPLLSSSENGTGGAEMAPADA - UNI15697 - ARTERLLNDLLPFCRPGPEGQLAATALQKV VLSLKQILLSTEEDSGAGPP

RDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLE ELEEEFCRLRPLLSQLGGTLSPNLAAPERSAQTG GLS
Transcript ENSMUST00000047873
Sequence
AGAGCCAGGAAGCCGGAGTCGGGACACCGGGCCCGGGATCCCCGAGCCCGACCTCGGGCGCCTCGCCGGTCACCTCCCCGCGCGGACACCAG - UNI78

18 - CCCGGCGGAGTCCTGGAGATGGGAGAAGTCGCCGGAGGGGCG GCCCCAGGGCCTCCCCGGTCTGGCCTGGTGTCCATCATCATCGGGGCGGAGG

ATGAGGATTTTGAGAACGAGCTGGAGGCG AACTCAGAAGATCAAAACAGCCAGTTCCAGAGCCTAGAGCAAGTGAAGCGCCGCCCTGCCCACCTCATGG

CCCTCCTGCAGCATGTGGCCCTGCAGTTCGAGCCAGGACCACTG - UNI20795 - CTCTGCTGCCTGCATGCAGACATGCTGAGCTCTCTGGGCCCC

AAAGAAGCCAAGAAGGCCTTCCTTGACTTCTATCACAGTTTCCTGGAGAAGACTGCG GTTCTACGGGTGCCGGTCCCTCCCAGTGTCGCTTTTGAACTT

G ATCGTACTCGACCTGATCTGATCTCTGAGGATGTCCAGAGGCGGTTCATACAAGAGGTGGTGCAGAGCCAGCAGGCAGCCGTGAGCCGTCAGCTAGAG

GACTTCCGCTCCAAGCGGCTCATGGGCATGACGCCCTGGGAGCAGGAACTGAGCCTGCTGGAGCCCTGGATTGGGAAAGACCGAGGCAACTATGAGGCCC

GGGAGCGGCATGTTGCGGAGCGGCTGCTGTCCCACCTGGAGGAGACCCA GCATACCATCTCTACAGATGAAGAGAAAAG TGCTGCTGTGGTCACTGCC

ATCAGCCTGTATATGCGCCACCTTGGAGTCCGGACCAAGAGTGGGGACAAGAAGTCGGGAAGGAACTTCTTCCGGAAAAAG GTGATGGGGAATCGGAGG

TCAGACGAACCCCCAAAGACAAAGAAAGGGCTGAGCAGTATCCTAGATCCTGCACGTTGGAACCGGGGAGAGCCATCCG CTCCAGATTGTCGACATCTA

AAGGTCGAGGCTGATG CAGAGAAGCCAGGCCCTGCAGACCGGAAGGGAGGCCTGGGTATGTCTTCTCGGGACAGGACTGTTGGGACTCCTGGACAGGAC

AACCCAGGAGTCTCCCTGCACCCTCTGTCTACAGACAGCGTCGACTCCCGGGAACCAG GCGTGGATACCCCGCAGGAGCCAGGGGATACACCCCCACAG

GGCCCTACCAGCCTGGAGCCCCTGGCGCCCCCAGAGAGCACAGAGGACAATGGCGAGACTGAGAG CCCTGAGCCCGGAGATGATGGGGAGCCAGGACGG

TCAGGCCTGGAACTGGAACCAGAAGAACCTCCTGGGTGGAGGGAACTCGTGCCCCCAGACACCCTGCTCAGTCTGCCCAAGAGCCAAGTGAAGCGGCAAG

AGGTCATCAGCG - UNI29342 - AGCTGCTCGTGACTGAGGCAGCTCACGTGCGCATGCTACGGGTACTGCATGACCTCTTCTACCAGCCCATGGCG

GATGGAGGCTTCTTCCCTCTGGACGAGCTGCAGAACATCTTCCCGAGCCTGGATGAGCTCATCGAGGTGCACT CCCTGTTCCTCGATCGCTTGATGAAG

CGGAGACAAGAGAGTGGCTACCTCATTGAGGAGATCGGCGATGTGCTACTGGCCCGG TTCGATGGTGCTGAGGGCTCATGGTTCCAGAAGATCTCCTCC

CGCTTCTGCAGCCGCCAGTCGTTCGCTCTAGAGCAGCTCAAAGCCAAGCAGCGCAAGGAGCCTCGGTTCTGTGCCTTTGTGCAG GAAGCTGAGAGCCGC

CCGAGATGCCGGCGCCTACAGTTAAAGGACATGATCCCCACTGAGATGCAGCGACTGACCAAGTACCCACTGCTGCTACAGAGCATCGGGCAGAACACAG

 AGGAGTCTACAGAACGAGGGAAAGTGGAGCTTGCAGCTGAGTGCTGCCGGGAGATTCTGCACCATGTCAATCAAGCCGTCCGTGACATGGAGGACCTGC

TG CGGCTCAAGGATTACCAGCGGCGCCTGGACTTGACTCACCTACGGCAGAGCAGTGACCCTATGCTGAGCGAGTTCAAG AACCTGGACATCACTAAG

AAGAAGTTGGTCCATGAAGGCCCCCTCACGTGGCGAGTGACCAAAGACAAAGCTATAG AAGTGCACGTGCTCTTGCTGGACGACCTGCTGCTGCTGCTC

CAGCGCCAGGACGAGAGGCTGCTGCTCAAGTCCCACAGCCGGACGCTGACACCTACCCCCGATGGCAAGACCATGCTGCGGCCGGTGCTCCGGCTCACCT

CTGCCATGACCCGAGAGGTGGCCACTG ATCACAAAGCTTTCTACGTCATTTTTACCTGGGACCAGGAGGCCCAGATATATGAGCTGGTGGCACAGACAT

CTTCGGAACGCAAAAA CTGGTGTAACCTCATCACTGAGACTGCTGGATCCCTGAAGGTCCCTGCCCCTGCCTCCCGCCTCAAACCCCGGCCCAGCCCAA

GCAG CATCCGAGAACCCCTGCTCAGCAGCTCTGAGAATGGCACTGGAGGCGCAGAGATGGCTCCAGCTGATG - UNI15697 - CCAGGACAGAGCG

GCTCCTCAATGACCTCCTGCCCTTCTGCAGACCAGGCCCAGAGGGCCAGCTTGCTGCCACAGCCCTTCAGAAAG TACTGTCCCTGAAGCAGATCCTGCT

AAGCACTGAGGAAGACAGTGGAGCGGGGCCTCCCCGCGATGGGGATGGGGTGCCTGGTGGTAGGGCCCCCGGCCCAGTGCACACCCAGGAGATTGAGGAA

AACTTGCTTAGCTTAGAGGTGGCCATCAGACAACTGGAG GAGTTGGAAGAGGAATTTTGTCGCCTAAGACCCCTCCTGTCCCAGCTTGGGGGGACTCTG

TCCCCCAACCTGGCTGCACCTGAACGCTCTGCTCAGACAG GCCTTTCATGAAGAGAAGAGTGGGGGAGAGGATGCAGGGGGGCCCACCCCCACCCCCAC

AGCTGCCACAGCATCTCACACCCCAGAGGCCTGGAGCAGAGGGAGATTGGCTGAACTTGATAGCAGACCTGCTCGGGTCCCTGCCTCCCACTCTGGCCTC

TGCCTTTCTCCCTCCTGCCTTCTGCTTGGGGAACTCAGGGCTTCACTCCCAGAGCACCCCCTTAATCCCCACTTTTCAGGCCGTCTCAGTATTGCCTATG

GGGGGTCACCCTCCTTCCCCTACCCCAAGTGCCTTTGCTATGTTTTTATATCCTGGACTGGAGGTTTATTTTTAATATATATTATCT
Translation
 - UNI7818 - MGEVAGGA APGPPRSGLVSIIIGAEDEDFENELEA NSEDQNSQFQSLEQVKRRPAHLMALLQHVALQFEPGPL - UNI20795 

- LCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTA VLRVPVPPSVAFELD DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQ

ELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQ QHTISTDEEKS SAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRKK VMGNRRSDEPPKTKKGL

SSILDPARWNRGEPSA APDCRHLKVEADA AEKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPG GVDTPQEPGDTPPQGPTSLE

PLAPPESTEDNGETES SPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVISE - UNI29342 - ELLVTEAAHVRMLRVLHDL

FYQPMADGGFFPLDELQNIFPSLDELIEVHS SLFLDRLMKRRQESGYLIEEIGDVLLAR FDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCA

FVQ EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTE EESTERGKVELAAECCREILHHVNQAVRDMEDLL RLKDYQRRLDLTHLRQSSDPM

LSEFK NLDITKKKLVHEGPLTWRVTKDKAIE EVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD DHKAFYVIF

TWDQEAQIYELVAQTSSERKN NWCNLITETAGSLKVPAPASRLKPRPSPSS SIREPLLSSSENGTGGAEMAPADA - UNI15697 - ARTERLLND

LLPFCRPGPEGQLAATALQKV VLSLKQILLSTEEDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLE ELEEEFCRLRPLLSQLGGTLSP

NLAAPERSAQTG GLS
Transcript ENSMUST00000098683
Sequence
AGAGCCAGGAAGCCGGAGTCGGGACACCGGGCCCGGGATCCCCGAGCCCGACCTCGGGCGCCTCGCCGGTCACCTCCCCGCGCGGACACCAG - UNI78

18 - CCCGGCGGAGTCCTGGAGATGGGAGAAGTCGCCGGAGGGGCG GCCCCAGGGCCTCCCCGGTCTGGCCTGGTGTCCATCATCATCGGGGCGGAGG

ATGAGGATTTTGAGAACGAGCTGGAGGCG AACTCAGAAGATCAAAACAGCCAGTTCCAGAGCCTAGAGCAAGTGAAGCGCCGCCCTGCCCACCTCATGG

CCCTCCTGCAGCATGTGGCCCTGCAGTTCGAGCCAGGACCACTG - UNI20795 - CTCTGCTGCCTGCATGCAGACATGCTGAGCTCTCTGGGCCCC

AAAGAAGCCAAGAAGGCCTTCCTTGACTTCTATCACAGTTTCCTGGAGAAGACTGCG GTTCTACGGGTGCCGGTCCCTCCCAGTGTCGCTTTTGAACTT

G ATCGTACTCGACCTGATCTGATCTCTGAGGATGTCCAGAGGCGGTTCATACAAGAGGTGGTGCAGAGCCAGCAGGCAGCCGTGAGCCGTCAGCTAGAG

GACTTCCGCTCCAAGCGGCTCATGGGCATGACGCCCTGGGAGCAGGAACTGAGCCTGCTGGAGCCCTGGATTGGGAAAGACCGAGGCAACTATGAGGCCC

GGGAGCGGCATGTTGCGGAGCGGCTGCTGTCCCACCTGGAGGAGACCCA GCATACCATCTCTACAGATGAAGAGAAAAG TGCTGCTGTGGTCACTGCC

ATCAGCCTGTATATGCGCCACCTTGGAGTCCGGACCAAGAGTGGGGACAAGAAGTCGGGAAGGAACTTCTTCCGGAAAAAG GTGATGGGGAATCGGAGG

TCAGACGAACCCCCAAAGACAAAGAAAGGGCTGAGCAGTATCCTAGATCCTGCACGTTGGAACCGGGGAGAGCCATCCG CTCCAGATTGTCGACATCTA

AAGGTCGAGGCTGATG AGAAGCCAGGCCCTGCAGACCGGAAGGGAGGCCTGGGTATGTCTTCTCGGGACAGGACTGTTGGGACTCCTGGACAGGACAAC

CCAGGAGTCTCCCTGCACCCTCTGTCTACAGACAGCGTCGACTCCCGGGAACCAG GCGTGGATACCCCGCAGGAGCCAGGGGATACACCCCCACAGGGC

CCTACCAGCCTGGAGCCCCTGGCGCCCCCAGAGAGCACAGAGGACAATGGCGAGACTGAGAG AAGGTGGAAGAG GCTATCAGGGCGTCTAGGGCGCTC

AGAGAGCCTGCGGGTGAGTGACCGCCGCCGGCCTTCCCGGGGCAGCCTCGGGGCTAAGGGCCGGGGTGGGGGCCGTTCCCGGAGCGACGTGGACATGGAC

CCGGGCTCCGCCACGGCCGTGCTTGGCCCCACCCGACGAGCCAC CCCTGAGCCCGGAGATGATGGGGAGCCAGGACGGTCAGGCCTGGAACTGGAACCA

GAAGAACCTCCTGGGTGGAGGGAACTCGTGCCCCCAGACACCCTGCTCAGTCTGCCCAAGAGCCAAGTGAAGCGGCAAGAGGTCATCAGCG - UNI293

42 - AGCTGCTCGTGACTGAGGCAGCTCACGTGCGCATGCTACGGGTACTGCATGACCTCTTCTACCAGCCCATGGCGGATGGAGGCTTCTTCCCTCTG

GACGAGCTGCAGAACATCTTCCCGAGCCTGGATGAGCTCATCGAGGTGCACT CCCTGTTCCTCGATCGCTTGATGAAGCGGAGACAAGAGAGTGGCTAC

CTCATTGAGGAGATCGGCGATGTGCTACTGGCCCGG TTCGATGGTGCTGAGGGCTCATGGTTCCAGAAGATCTCCTCCCGCTTCTGCAGCCGCCAGTCG

TTCGCTCTAGAGCAGCTCAAAGCCAAGCAGCGCAAGGAGCCTCGGTTCTGTGCCTTTGTGCAG GAAGCTGAGAGCCGCCCGAGATGCCGGCGCCTACAG

TTAAAGGACATGATCCCCACTGAGATGCAGCGACTGACCAAGTACCCACTGCTGCTACAGAGCATCGGGCAGAACACAG AGGAGTCTACAGAACGAGGG

AAAGTGGAGCTTGCAGCTGAGTGCTGCCGGGAGATTCTGCACCATGTCAATCAAGCCGTCCGTGACATGGAGGACCTGCTG CGGCTCAAGGATTACCAG

CGGCGCCTGGACTTGACTCACCTACGGCAGAGCAGTGACCCTATGCTGAGCGAGTTCAAG AACCTGGACATCACTAAGAAGAAGTTGGTCCATGAAGGC

CCCCTCACGTGGCGAGTGACCAAAGACAAAGCTATAG AAGTGCACGTGCTCTTGCTGGACGACCTGCTGCTGCTGCTCCAGCGCCAGGACGAGAGGCTG

CTGCTCAAGTCCCACAGCCGGACGCTGACACCTACCCCCGATGGCAAGACCATGCTGCGGCCGGTGCTCCGGCTCACCTCTGCCATGACCCGAGAGGTGG

CCACTG ATCACAAAGCTTTCTACGTCATTTTTACCTGGGACCAGGAGGCCCAGATATATGAGCTGGTGGCACAGACATCTTCGGAACGCAAAAA CTGG

TGTAACCTCATCACTGAGACTGCTGGATCCCTGAAGGTCCCTGCCCCTGCCTCCCGCCTCAAACCCCGGCCCAGCCCAAGCAG CATCCGAGAACCCCTG

CTCAGCAGCTCTGAGAATGGCACTGGAGGCGCAGAGATGGCTCCAGCTGATG - UNI15697 - CCAGGACAGAGCGGCTCCTCAATGACCTCCTGCC

CTTCTGCAGACCAGGCCCAGAGGGCCAGCTTGCTGCCACAGCCCTTCAGAAAG TACTGTCCCTGAAGCAGATCCTGCTAAGCACTGAGGAAGACAGTGG

AGCGGGGCCTCCCCGCGATGGGGATGGGGTGCCTGGTGGTAGGGCCCCCGGCCCAGTGCACACCCAGGAGATTGAGGAAAACTTGCTTAGCTTAGAGGTG

GCCATCAGACAACTGGAG GAGTTGGAAGAGGAATTTTGTCGCCTAAGACCCCTCCTGTCCCAGCTTGGGGGGACTCTGTCCCCCAACCTGGCTGCACCT

GAACGCTCTGCTCAGACAG GCCTTTCATGAAGAGAAGAGTGGGGGAGAGGATGCAGGGGGGCCCACCCCCACCCCCACAGCTGCCACAGCATCTCACAC

CCCAGAGGCCTGGAGCAGAGGGAGATTGGCTGAACTTGATAGCAGACCTGCTCGGGTCCCTGCCTCCCACTCTGGCCTCTGCCTTTCTCCCTCCTGCCTT

CTGCTTGGGGAACTCAGGGCTTCACTCCCAGAGCACCCCCTTAATCCCCACTTTTCAGGCCGTCTCAGTATTGCCTATGGGGGGTCACCCTCCTTCCCCT

ACCCCAAGTGCCTTTGCTATGTTTTTATATCCTGGACTGGAGGTTTATTTTTAATATATATTATCT
Translation
 - UNI7818 - MGEVAGGA APGPPRSGLVSIIIGAEDEDFENELEA NSEDQNSQFQSLEQVKRRPAHLMALLQHVALQFEPGPL - UNI20795 

- LCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTA VLRVPVPPSVAFELD DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQ

ELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQ QHTISTDEEKS SAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRKK VMGNRRSDEPPKTKKGL

SSILDPARWNRGEPSA APDCRHLKVEADE EKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPG GVDTPQEPGDTPPQGPTSLEP

LAPPESTEDNGETER RRWKR RLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPGSATAVLGPTRRAT TPEPGDDGEPGRSGLELEPE

EPPGWRELVPPDTLLSLPKSQVKRQEVISE - UNI29342 - ELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHS SLFLD

RLMKRRQESGYLIEEIGDVLLAR FDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQ EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQS

IGQNTE EESTERGKVELAAECCREILHHVNQAVRDMEDLL RLKDYQRRLDLTHLRQSSDPMLSEFK NLDITKKKLVHEGPLTWRVTKDKAIE EVHV

LLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD DHKAFYVIFTWDQEAQIYELVAQTSSERKN NWCNLITETAGSLKV

PAPASRLKPRPSPSS SIREPLLSSSENGTGGAEMAPADA - UNI15697 - ARTERLLNDLLPFCRPGPEGQLAATALQKV VLSLKQILLSTEEDS

GAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLE ELEEEFCRLRPLLSQLGGTLSPNLAAPERSAQTG GLS
Transcript ENSMUST00000108424
Sequence
GACTCTGCGGCACGGGTGGGGGAACCTGGAGCTCGAGCGCGGAGGCTTCGGTTCCTGAGGCTGCAGTGGCTTGCTTCTCTTCCCATCCGACAG - UNI7

818 - CCCGGCGGAGTCCTGGAGATGGGAGAAGTCGCCGGAGGGGCG GCCCCAGGGCCTCCCCGGTCTGGCCTGGTGTCCATCATCATCGGGGCGGAG

GATGAGGATTTTGAGAACGAGCTGGAGGCG AACTCAGAAGATCAAAACAGCCAGTTCCAGAGCCTAGAGCAAGTGAAGCGCCGCCCTGCCCACCTCATG

GCCCTCCTGCAGCATGTGGCCCTGCAGTTCGAGCCAGGACCACTG - UNI20795 - CTCTGCTGCCTGCATGCAGACATGCTGAGCTCTCTGGGCCC

CAAAGAAGCCAAGAAGGCCTTCCTTGACTTCTATCACAGTTTCCTGGAGAAGACTGCG GTTCTACGGGTGCCGGTCCCTCCCAGTGTCGCTTTTGAACT

TG ATCGTACTCGACCTGATCTGATCTCTGAGGATGTCCAGAGGCGGTTCATACAAGAGGTGGTGCAGAGCCAGCAGGCAGCCGTGAGCCGTCAGCTAGA

GGACTTCCGCTCCAAGCGGCTCATGGGCATGACGCCCTGGGAGCAGGAACTGAGCCTGCTGGAGCCCTGGATTGGGAAAGACCGAGGCAACTATGAGGCC

CGGGAGCGGCATGTTGCGGAGCGGCTGCTGTCCCACCTGGAGGAGACCCA GCATACCATCTCTACAGATGAAGAGAAAAG TGCTGCTGTGGTCACTGC

CATCAGCCTGTATATGCGCCACCTTGGAGTCCGGACCAAGAGTGGGGACAAGAAGTCGGGAAGGAACTTCTTCCGGAAAAAG GTGATGGGGAATCGGAG

GTCAGACGAACCCCCAAAGACAAAGAAAGGGCTGAGCAGTATCCTAGATCCTGCACGTTGGAACCGGGGAGAGCCATCCG CTCCAGATTGTCGACATCT

AAAGGTCGAGGCTGATG CAGAGAAGCCAGGCCCTGCAGACCGGAAGGGAGGCCTGGGTATGTCTTCTCGGGACAGGACTGTTGGGACTCCTGGACAGGA

CAACCCAGGAGTCTCCCTGCACCCTCTGTCTACAGACAGCGTCGACTCCCGGGAACCAG GCGTGGATACCCCGCAGGAGCCAGGGGATACACCCCCACA

GGGCCCTACCAGCCTGGAGCCCCTGGCGCCCCCAGAGAGCACAGAGGACAATGGCGAGACTGAGAG CCCTGAGCCCGGAGATGATGGGGAGCCAGGACG

GTCAGGCCTGGAACTGGAACCAGAAGAACCTCCTGGGTGGAGGGAACTCGTGCCCCCAGACACCCTGCTCAGTCTGCCCAAGAGCCAAGTGAAGCGGCAA

GAGGTCATCAGCG - UNI29342 - AGCTGCTCGTGACTGAGGCAGCTCACGTGCGCATGCTACGGGTACTGCATGACCTCTTCTACCAGCCCATGGC

GGATGGAGGCTTCTTCCCTCTGGACGAGCTGCAGAACATCTTCCCGAGCCTGGATGAGCTCATCGAGGTGCACT CCCTGTTCCTCGATCGCTTGATGAA

GCGGAGACAAGAGAGTGGCTACCTCATTGAGGAGATCGGCGATGTGCTACTGGCCCGG TTCGATGGTGCTGAGGGCTCATGGTTCCAGAAGATCTCCTC

CCGCTTCTGCAGCCGCCAGTCGTTCGCTCTAGAGCAGCTCAAAGCCAAGCAGCGCAAGGAGCCTCGGTTCTGTGCCTTTGTGCAG GAAGCTGAGAGCCG

CCCGAGATGCCGGCGCCTACAGTTAAAGGACATGATCCCCACTGAGATGCAGCGACTGACCAAGTACCCACTGCTGCTACAGAGCATCGGGCAGAACACA

G AGGAGTCTACAGAACGAGGGAAAGTGGAGCTTGCAGCTGAGTGCTGCCGGGAGATTCTGCACCATGTCAATCAAGCCGTCCGTGACATGGAGGACCTG

CTG CGGCTCAAGGATTACCAGCGGCGCCTGGACTTGACTCACCTACGGCAGAGCAGTGACCCTATGCTGAGCGAGTTCAAG AACCTGGACATCACTAA

GAAGAAGTTGGTCCATGAAGGCCCCCTCACGTGGCGAGTGACCAAAGACAAAGCTATAG AAGTGCACGTGCTCTTGCTGGACGACCTGCTGCTGCTGCT

CCAGCGCCAGGACGAGAGGCTGCTGCTCAAGTCCCACAGCCGGACGCTGACACCTACCCCCGATGGCAAGACCATGCTGCGGCCGGTGCTCCGGCTCACC

TCTGCCATGACCCGAGAGGTGGCCACTG ATCACAAAGCTTTCTACGTCATTTTTACCTGGGACCAGGAGGCCCAGATATATGAGCTGGTGGCACAGACA

TCTTCGGAACGCAAAAA CTGGTGTAACCTCATCACTGAGACTGCTGGATCCCTGAAGGTCCCTGCCCCTGCCTCCCGCCTCAAACCCCGGCCCAGCCCA

AGCAG - UNI15697 - CATCTCACACCCCAGAGGCCTGGAGCAGAGGGAGATTGGCTGA
Translation
 - UNI7818 - MGEVAGGA APGPPRSGLVSIIIGAEDEDFENELEA NSEDQNSQFQSLEQVKRRPAHLMALLQHVALQFEPGPL - UNI20795 

- LCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTA VLRVPVPPSVAFELD DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQ

ELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQ QHTISTDEEKS SAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRKK VMGNRRSDEPPKTKKGL

SSILDPARWNRGEPSA APDCRHLKVEADA AEKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPG GVDTPQEPGDTPPQGPTSLE

PLAPPESTEDNGETES SPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVISE - UNI29342 - ELLVTEAAHVRMLRVLHDL

FYQPMADGGFFPLDELQNIFPSLDELIEVHS SLFLDRLMKRRQESGYLIEEIGDVLLAR FDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCA

FVQ EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTE EESTERGKVELAAECCREILHHVNQAVRDMEDLL RLKDYQRRLDLTHLRQSSDPM

LSEFK NLDITKKKLVHEGPLTWRVTKDKAIE EVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD DHKAFYVIF

TWDQEAQIYELVAQTSSERKN NWCNLITETAGSLKVPAPASRLKPRPSPSS - UNI15697 - SISHPRGLEQREIG

For any suggestions or comments, please send an email to unitrap@crg.es