Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041046 (Ramp3)
Chromosomal location
Chr 11: 6558568 - 6577475 (+)
Description
receptor (calcitonin) activity modifying protein 3 Gene [Source:MGI (curated);Acc:Ramp3-001]
RefSeq_dna
NM_019511 
RefSeq_peptide
NP_062384.1 
UniGene
Mm.39884 
MGI
MGI:1860292 
Uniprot/SWISSPROT
Q9WUP1 
Uniprot/SPTREMBL
Q5SWP4 
Human Ortholog
ENSG00000122679 (RAMP3)
Omim not available
UniTrap UNI16235
Vector Insertion
Chr 11: 6558631 - 6574765
Public Clones not available
Private Clones OST464697 (lexicon) OST188192 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045374
Sequence
AGTTGGCCATGAAGACCCCAGCACAGCGGCTGCACCTTCTTCCACTGTTGTTGCTGCTTTGTG - UNI16235 - GTGAGTGTGCCCAGGTATGCGGC

TGCAACGAGACAGGGATGCTGGAGAGGCTGCCTCGCTGTGGGAAAGCCTTCGCTGACATGATGCAGAAGGTGGCTGTCTGGAAGTGGTGCAACCTGTCGG

AGTTCATCGT GTATTATGAAAGCTTCACTAACTGCACCGAGATGGAGACCAACATCATGGGCTGCTACTGGCCCAACCCGCTGGCCCAGAGCTTCATCA

CTGGAATCCACAGGCAGTTCTTTTCCAACTGCACGGTGGACAGGACCCACTGGGAAGACCCCCCGGATGAAGTACTCATCCCACTGATCGCGGTTCCTGT

CGTGCTGACTGTGGCTATGGCTGGCCTGGTGGTGTGGCGCAGCAAGCACACTGATCGGCTGCTGTGAGGATCTGCTGGATGGAGGGCCATGCCTGGCAGG

CTGGGAGAATGTTGCTCAGAGCTCTGAGAGCTGGCAGACTCGGCTTCTGTCTGGTTTGCTTTGGCCACACCCTACCTGGCCATGCCAAAGTCCTCCTGAC

CAGGCTGGTGTGGCCCTTGCTGTCTAGCCTGCCGCCTGCTGGGGTTCAGATTGTCCATACTTTGCTCTTTCTTGGGCTAGTGGAAGAAAGTGACAAATCC

CAAGTTTGTGGACCAGGCATGGAAATCAACTGTTGCTGAGCCCCGCTCCCCAGGCTCGGTTCCCTAGTTTCTAGCCGTTTCTTGGCAGAGTCTTGCTCAG

CCTGAACCCCGCCCCAGGTCCTGACCCATTTCTAGTCCTGACCCTGACCCCTGCTACACTTGGCCAGAGAGGGCAGGCAAGGTCATCTGGAAGATGTGGA

CGCCCCCCCGCCTCTGTTCAAGAGACTGAGCACATCATTTATCAGACATGAAGGATAGCCTGGGGTCATTAGGAGCCACGTGTGACCTACTGACCCACCT

GCCTGTCCTCTCTGTGATCTGTCACGATTCTGTGTCCAGTGTGGGCTGGAGCTGTGGCTTGTTTAGCCCTTCAAAGACACCTACCCTGCAGGTAGAGCGT

GAACCTCCTTCTTGAGGGGTATTCCTGGGAGTGGGGCGCACTGAGTGTGCTCAAGGGTTCTGTCTGCTGATGTCAGTTCTTTTTGATTAAAGTGTCTCCT

T
Translation
MKTPAQRLHLLPLLLLLCG - UNI16235 - GECAQVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIV VYYESFTNCTEMETNIMGCYW

PNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEVLIPLIAVPVVLTVAMAGLVVWRSKHTDRLL

For any suggestions or comments, please send an email to unitrap@crg.es