Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041130 (Zfp598)
Chromosomal location
Chr 17: 24806697 - 24818960 (+)
Description
zinc finger protein 598 Gene [Source:MGI Symbol;Acc:MGI:2670965]
RefSeq_dna
NM_183149 
RefSeq_peptide
NP_898972.1 
UniGene
Mm.219581 
MGI
MGI:2670965 
Uniprot/SWISSPROT
Q80YR4 
Human Ortholog
ENSG00000167962 (ZNF598)
Omim not available
UniTrap UNI29809
Vector Insertion
Chr 17: 24806919 - 24813498
Public Clones E062D02 (ggtc) D160D02 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088395
Sequence
CCGGCCATGGCGGCGGCGGCGGGCGCCGAGGGGCGGCGCGCGGCTCTGGAGGCGGTGGCAGCGCCGGAGCGGGGCGGCGGGAGCTGCGTGCTGTGCTGCG

GTGACCTGGAGGCTACGGCGCTGGGCCGCTGCGATCACCCGGTGTGCTACCGGTGCTCTACCAAGATGCGGGTGCTGTGCGAGCAGCGCTACTGCGCCGT

GTGCCGCGAGGAGCTGCGCCAG - UNI29809 - GTGGTCTTTGGGAAGAAACTCCCTGCTTTTGCCCTGATCCCCATCCATCAGCTCCAACACGAGA

AGAAATATGACATCTATTTTGCAGATGGAAAGGTGTTTGCATTGTACAG GCAGCTGCTGCAGCATGAGTGCCCACGGTGCCCTCACCTGCCACCCTTCA

GCCTCTTCGGGGACTTGGAGCAGCACATGCGCAAGCAGCATGAGCTCTTCTGCTGCAAGTTGTGCCTCAAGCACCTCAAG ATCTTCACCTATGAACGCA

AGTGGTACTCACGCAAGGACCTGGCTCGACACCGTATGCAGGGTGACCCTGATGATACATCCCATCGGGGACATCCACTCTGTAAGTTCTGTGACGAGCG

CTACCTGGACAATGACGAGCTGCTCAAGCACCTGCGCCGAGACCACTACTTCTGCCACTTCTGTGACTCTGATGGGGCCCAGGACTACTATAG TGACTA

TGCCTACCTGCGTGAGCACTTCCGGGAGAAGCACTTCCTGTGTGAGGAGGGCCGCTGCAGCACTGAGCAGTTCACCCATGCCTTCCGCACCGAGATCGAC

CTCAAGGCTCATAAAACAGCTTGCCACAGCCGCAGCCGGGCCGAGGCACGCCAGAACCGGCAGATTGACCTTCAGTTTAGCTTTGCACCACGGCACTCAC

GCCGGAGTGAGG GAGTCGTCAGTGGTGAGGACTACGAGGAGGTGGACAGGTACAATCGCCAGGGCCGAGCTGGCCGGGCCAGCGGGCGTGGAGCCCAGC

AGAACCGCCGGGGAAGCTGGAGGTACAAGAG GGAAGAAGAAGACCGAGAAGTGGCAGCTGCTATCCGGGCCTCTGTGGCTGCTCAACAGCAAGAGGAGA

CTCAGAGGGTTGAGGACCGGGAGGAGGGTAGCAGGCCCAAGAAAGAGGAAGCCGCAGCCAGGGTGCCTGAGGAACCCCGTGGCCACCGGCGTCTGCCTCG

GGCTCAGGGTGAAGGCTCAG GCTCCAAGGAAGCCTCAGCAAATGGTCCTGTAAGCCAAGAAGCCTTCCCAGCCACAGGCCCAGGCCCAGTGGTTGCCCT

CTCAAA TACCCTCCCACCACCCAGCCCTGAGCTCAAGGAGGAAGACTTCCCCAGTCTCTGTGCCTCCACCTCCTCCTGCTGCACAGCGGTTACCCCAGG

CTCTGTAGGCTTGGCACTGGCTTATCCTGGTCCTCCCAGGGGCAAGAACACCTTCCAGGAAGAGGACTTTCCTGCCTTGGTTTCCTCCGCACCCAAGCCC

AGCAGTGCCCCTTCCAGTCTCATCTCAGCTTGGAATAGCGGCTGCAGCAAGAAAGGGAACCTACCCACCCCGGGGTCCCAGGCTGTGGTTGGTGGCAGCC

AGCCTCCCCGGAAGGCAGGAAAGGGGAGCAGGGGTGGCAGAAAGGGTGGCCCAGCCCCAGTGGATGAGGAGGATAGCGGTGGCCTCACTGTGCAGGGGCT

GCGGAGTGTGCCCACCACGGTAGCTGTGTCTTCTTTGCTGGCACCAGCCACCAACCAGAGTTCAGCCAAGGTTGGCAAGAAGAAGAAGGTGGGCTCTGAG

AAGCCTGGGGCCACATCATCCCCACTGTTGCCCCCTGATCATACCCCAAAGCCCTCTGGGGCTGAGCAGGTCCTGGAAGCCCCTTTGAGCAAAGCTGAAG

T GCCCCTCGGTCCCCTCCCCTGCCCCATACCACAGGAGGACTTTCCAGCTCTCGGAGGCCCTTGTCCACCCAGGATGCCTCCTCCCCCAG GCTTCAGC

ACCGTGGTACTCTTGAAGGGCACACCACCTCCACCCCCACCCCCACCCGGCCTGGTGCCTCCCATCAGCAAGCCACCCCCTGGCTTCTCTAGTCTTCTGC

CCAGCTCCCACTCAGCCTGTGCTCCTAGTCCCACCACCACAACCACCACCACCACCACCACGAAAAC ACCCGGGCTAGCACCCACACCACAAGCCTACT

TAGTTCCTGAGAATTTCCGGGAGAGAAACCTGCAGCTTATCCAGTCTATCAAGGACTTTCTGCAAAGCGATGAGGCCTGCTTCAGCAAGTTTAAAAGCCA

TTCGGGGGAGTTCAGACAG GGGATGATCTCTGCGGCTCAGTACTACAAGAGCTGCAGGGACCTGCTTGGAGAGAGCTTCCAGAAGATCTTCAGTGAGCT

GCTGGCGCTCCTGCCAGACACAGCCAAACAGCAGGAGCTGCTGTCTGCACACACAGACTTCTGCAGTCGTGAGAAGCCTCCCAACTCCAGATCTAAGAGG

AACAAGAAGAATGTGTGGCAGACCAGCACCCAACAGTTGGGCCTGGACTGCTGTGTGTGCCCCACCTGCCAGCAGGTACTGGCACACGGTGACGTCAGCA

GCCACCAGGCACTGCACGCTGCCCGGGACGATGACTTCCCCTCCCTTCAAGCCATTGCCAGGATCATTACGTAGCTGCTGCTGGTGAGGGCAGGAGCTGT

CACACCCTAGCGCCTCCTTTCTCCTTCCTCCCTCTTCCCAGCTGCTTGGCCCTGGTAGGGCCCTGGGAAGGCCGAAGGCCAGGCCTCCTGGTTAGCCAGG

CCTGCCAGGTGGACATCAGGAAAGGTCTACCCTGTGCACCGTCACTCATAAGTTCTGTCCCATGCTTGGCTGAGGGTCAGTCTTGGTTTGTGATCTTGTG

ATTTTGGAATGTGCCAGGGGAGGGAAAGGCTAGGATGCTGGGACCTGAGCTAGAGGCCTCAGTGGCCTGAAGAGAGTTCTCGTGAGGCAAGTCCATAGCC

CCAGAGCTGACAGCTTCGGGTCCACTGGTGCTGGAGTCAGATGTCAAGTGTGTTGTGTAAACAATTGGCTGTTTCATAGAGAATGTTCCAGATTAAAAAC

AGACACAAAATTGTGCTACTTGAAGTTCAATCTTTTTACAAGACAAGTTAAATCTAAGATCTCAAATTGCCTCTGACATTTTATAAAAGACAGTTTATCT

TCAAATAAATTTATTTTGCAGTACTGC
Translation
MAAAAGAEGRRAALEAVAAPERGGGSCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQ - UNI29809 - VVFGKKLPAFALIP

IHQLQHEKKYDIYFADGKVFALYR RQLLQHECPRCPHLPPFSLFGDLEQHMRKQHELFCCKLCLKHLK IFTYERKWYSRKDLARHRMQGDPDDTSHRG

HPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYS SDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSRSRAEARQNRQI

DLQFSFAPRHSRRSEG GVVSGEDYEEVDRYNRQGRAGRASGRGAQQNRRGSWRYKR REEEDREVAAAIRASVAAQQQEETQRVEDREEGSRPKKEEAA

ARVPEEPRGHRRLPRAQGEGSG GSKEASANGPVSQEAFPATGPGPVVALSN NTLPPPSPELKEEDFPSLCASTSSCCTAVTPGSVGLALAYPGPPRGK

NTFQEEDFPALVSSAPKPSSAPSSLISAWNSGCSKKGNLPTPGSQAVVGGSQPPRKAGKGSRGGRKGGPAPVDEEDSGGLTVQGLRSVPTTVAVSSLLAP

ATNQSSAKVGKKKKVGSEKPGATSSPLLPPDHTPKPSGAEQVLEAPLSKAEV VPLGPLPCPIPQEDFPALGGPCPPRMPPPPG GFSTVVLLKGTPPPP

PPPPGLVPPISKPPPGFSSLLPSSHSACAPSPTTTTTTTTTTKT TPGLAPTPQAYLVPENFRERNLQLIQSIKDFLQSDEACFSKFKSHSGEFRQ GMI

SAAQYYKSCRDLLGESFQKIFSELLALLPDTAKQQELLSAHTDFCSREKPPNSRSKRNKKNVWQTSTQQLGLDCCVCPTCQQVLAHGDVSSHQALHAARD

DDFPSLQAIARIIT
Transcript ENSMUST00000047179
Sequence
CCGGCCATGGCGGCGGCGGCGGGCGCCGAGGGGCGGCGCGCGGCTCTGGAGGCGGTGGCAGCGCCGGAGCGGGGCGGCGGGAGCTGCGTGCTGTGCTGCG

GTGACCTGGAGGCTACGGCGCTGGGCCGCTGCGATCACCCGGTGTGCTACCGGTGCTCTACCAAGATGCGGGTGCTGTGCGAGCAGCGCTACTGCGCCGT

GTGCCGCGAGGAGCTGCGCCAG - UNI29809 - GTGGTCTTTGGGAAGAAACTCCCTGCTTTTGCCCTGATCCCCATCCATCAGCTCCAACACGAGA

AGAAATATGACATCTATTTTGCAGATGGAAAGGTGTTTGCATTGTACAG GCAGCTGCTGCAGCATGAGTGCCCACGGTGCCCTCACCTGCCACCCTTCA

GCCTCTTCGGGGACTTGGAGCAGCACATGCGCAAGCAGCATGAGCTCTTCTGCTGCAAGTTGTGCCTCAAGCACCTCAAG ATCTTCACCTATGAACGCA

AGTGGTACTCACGCAAGGACCTGGCTCGACACCGTATGCAGGGTGACCCTGATGATACATCCCATCGGGGACATCCACTCTGTAAGTTCTGTGACGAGCG

CTACCTGGACAATGACGAGCTGCTCAAGCACCTGCGCCGAGACCACTACTTCTGCCACTTCTGTGACTCTGATGGGGCCCAGGACTACTATAG TGACTA

TGCCTACCTGCGTGAGCACTTCCGGGAGAAGCACTTCCTGTGTGAGGAGGGCCGCTGCAGCACTGAGCAGTTCACCCATGCCTTCCGCACCGAGATCGAC

CTCAAGGCTCATAAAACAGCTTGCCACAGCCGCAGCCGGGCCGAGGCACGCCAGAACCGGCAGATTGACCTTCAGTTTAGCTTTGCACCACGGCACTCAC

GCCGGAGTGAGG GAGTCGTCAGTGGTGAGGACTACGAGGAGGTGGACAGGTACAATCGCCAGGGCCGAGCTGGCCGGGCCAGCGGGCGTGGAGCCCAGC

AGAACCGCCGGGGAAGCTGGAGGTACAAGAG GGAAGAAGAAGACCGAGAAGTGGCAGCTGCTATCCGGGCCTCTGTGGCTGCTCAACAGCAAGAGGAGA

CTCAGAGGGTTGAGGACCGGGAGGAGGGTAGCAGGCCCAAGAAAGAGGAAGCCGCAGCCAGGGTGCCTGAGGAACCCCGTGGCCACCGGCGTCTGCCTCG

GGCTCAGGGTGAAGGCTCAG GCTCCAAGGAAGCCTCAGCAAATGGTCCTGTAAGCCAAGAAGCCTTCCCAGCCACAGGCCCAGGCCCAGTGGTTGCCCT

CTCAAA TACCCTCCCACCACCCAGCCCTGAGCTCAAGGAGGAAGACTTCCCCAGTCTCTGTGCCTCCACCTCCTCCTGCTGCACAGCGGTTACCCCAGG

CTCTGTAGGCTTGGCACTGGCTTATCCTGGTCCTCCCAGGGGCAAGAACACCTTCCAGGAAGAGGACTTTCCTGCCTTGGTTTCCTCCGCACCCAAGCCC

AGCAGTGCCCCTTCCAGTCTCATCTCAGCTTGGAATAGCGGCTGCAGCAAGAAAGGGAACCTACCCACCCCGGGGTCCCAGGCTGTGGTTGGTGGCAGCC

AGCCTCCCCGGAAGGCAGGAAAGGGGAGCAGGGGTGGCAGAAAGGGTGGCCCAGCCCCAGTGGATGAGGAGGATAGCGGTGGCCTCACTGTGCAGGGGCT

GCGGAGTGTGCCCACCACGGTAGCTGTGTCTTCTTTGCTGGCACCAGCCACCAACCAGAGTTCAGCCAAGGTTGGCAAGAAGAAGAAGGTGGGCTCTGAG

AAGCCTGGGGCCACATCATCCCCACTGTTGCCCCCTGATCATACCCCAAAGCCCTCTGGGGCTGAGCAGGTCCTGGAAGCCCCTTTGAGCAAAGCTGAAG

TGCCAGTAACCATCGTTGTCAATGGACATTCCGAAGGGTCAGCCCTGGTACGGAGTGCCCCAAAGGAACCTCCAGGGCTTCCAAGGCCCCTCGGTCCCCT

CCCCTGCCCCATACCACAGGAGGACTTTCCAGCTCTCGGAGGCCCTTGTCCACCCAGGATGCCTCCTCCCCCAG GCTTCAGCACCGTGGTACTCTTGAA

GGGCACACCACCTCCACCCCCACCCCCACCCGGCCTGGTGCCTCCCATCAGCAAGCCACCCCCTGGCTTCTCTAGTCTTCTGCCCAGCTCCCACTCAGCC

TGTGCTCCTAGTCCCACCACCACAACCACCACCACCACCACCACGAAAAC ACCCGGGCTAGCACCCACACCACAAGCCTACTTAGTTCCTGAGAATTTC

CGGGAGAGAAACCTGCAGCTTATCCAGTCTATCAAGGACTTTCTGCAAAGCGATGAGGCCTGCTTCAGCAAGTTTAAAAGCCATTCGGGGGAGTTCAGAC

AG GGGATGATCTCTGCGGCTCAGTACTACAAGAGCTGCAGGGACCTGCTTGGAGAGAGCTTCCAGAAGATCTTCAGTGAGCTGCTGGCGCTCCTGCCAG

ACACAGCCAAACAGCAGGAGCTGCTGTCTGCACACACAGACTTCTGCAGTCGTGAGAAGCCTCCCAACTCCAGATCTAAGAGGAACAAGAAGAATGTGTG

GCAGACCAGCACCCAACAGTTGGGCCTGGACTGCTGTGTGTGCCCCACCTGCCAGCAGGTACTGGCACACGGTGACGTCAGCAGCCACCAGGCACTGCAC

GCTGCCCGGGACGATGACTTCCCCTCCCTTCAAGCCATTGCCAGGATCATTACGTAGCTGCTGCTGGTGAGGGCAGGAGCTGTCACACCCTAGCGCCTCC

TTTCTCCTTCCTCCCTCTTCCCAGCTGCTTGGCCCTGGTAGGGCCCTGGGAAGGCCGAAGGCCAGGCCTCCTGGTTAGCCAGGCCTGCCAGGTGGACATC

AGGAAAGGTCTACCCTGTGCACCGTCACTCATAAGTTCTGTCCCATGCTTGGCTGAGGGTCAGTCTTGGTTTGTGATCTTGTGATTTTGGAATGTGCCAG

GGGAGGGAAAGGCTAGGATGCTGGGACCTGAGCTAGAGGCCTCAGTGGCCTGAAGAGAGTTCTCGTGAGGCAAGTCCATAGCCCCAGAGCTGACAGCTTC

GGGTCCACTGGTGCTGGAGTCAGATGTCAAGTGTGTTGTGTAAACAATTGGCTGTTTCATAGAGAATGTTCCAGATTAAAAACAGACACAAAATTGTGCT

ACTTGAAGTTCAATCTTTTTACAAGACAAGTTAAATCTAAGATCTCAAATTGCCTCTGACATTTTATAAAAGACAGTTTATCTTCAAATAAATTTATTTT

GCAGTACTGC
Translation
MAAAAGAEGRRAALEAVAAPERGGGSCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQ - UNI29809 - VVFGKKLPAFALIP

IHQLQHEKKYDIYFADGKVFALYR RQLLQHECPRCPHLPPFSLFGDLEQHMRKQHELFCCKLCLKHLK IFTYERKWYSRKDLARHRMQGDPDDTSHRG

HPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYS SDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSRSRAEARQNRQI

DLQFSFAPRHSRRSEG GVVSGEDYEEVDRYNRQGRAGRASGRGAQQNRRGSWRYKR REEEDREVAAAIRASVAAQQQEETQRVEDREEGSRPKKEEAA

ARVPEEPRGHRRLPRAQGEGSG GSKEASANGPVSQEAFPATGPGPVVALSN NTLPPPSPELKEEDFPSLCASTSSCCTAVTPGSVGLALAYPGPPRGK

NTFQEEDFPALVSSAPKPSSAPSSLISAWNSGCSKKGNLPTPGSQAVVGGSQPPRKAGKGSRGGRKGGPAPVDEEDSGGLTVQGLRSVPTTVAVSSLLAP

ATNQSSAKVGKKKKVGSEKPGATSSPLLPPDHTPKPSGAEQVLEAPLSKAEVPVTIVVNGHSEGSALVRSAPKEPPGLPRPLGPLPCPIPQEDFPALGGP

CPPRMPPPPG GFSTVVLLKGTPPPPPPPPGLVPPISKPPPGFSSLLPSSHSACAPSPTTTTTTTTTTKT TPGLAPTPQAYLVPENFRERNLQLIQSIK

DFLQSDEACFSKFKSHSGEFRQ GMISAAQYYKSCRDLLGESFQKIFSELLALLPDTAKQQELLSAHTDFCSREKPPNSRSKRNKKNVWQTSTQQLGLDC

CVCPTCQQVLAHGDVSSHQALHAARDDDFPSLQAIARIIT

For any suggestions or comments, please send an email to unitrap@crg.es