Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041215 (Yeats2)
Chromosomal location
Chr 16: 20141181 - 20232646 (+)
Description
YEATS domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:2447762]
RefSeq_dna
NM_001033237 
RefSeq_peptide
NP_001028409.1 
UniGene
Mm.390895 Mm.396508 
MGI
MGI:2447762 
Uniprot/SWISSPROT
Q3TUF7 
Human Ortholog
ENSG00000163872 (YEATS2)
Omim not available
UniTrap UNI36255
Vector Insertion
Chr 16: 20141309 - 20150533
Public Clones (sanger) IST10024A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34667
Vector Insertion
Chr 16: 20159326 - 20162048
Public Clones IST10442F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2827
Vector Insertion
Chr 16: 20174613 - 20179573
Public Clones AG0348 (sanger) AX0471 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36303
Vector Insertion
Chr 16: 20179749 - 20186323
Public Clones IST12351H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33042
Vector Insertion
Chr 16: 20189571 - 20190458
Public Clones IST10708B4 (tigm) IST10040B1 (tigm) IST10249A10 (tigm) IST14692G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17032
Vector Insertion
Chr 16: 20190563 - 20193231
Public Clones IST12472A6 (tigm) IST12155D9 (tigm) IST12322E8 (tigm) IST12835E8 (tigm)
IST11670D7 (tigm) IST13963H4 (tigm)
Private Clones OST450594 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7927
Vector Insertion
Chr 16: 20193900 - 20203727
Public Clones RRM158 (baygenomics) RRK335 (baygenomics) PT193 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090052
Sequence
GAGCTTCCGCGCGGGCGCGTCCCGGGCCTCGCACGGCGGTTCCACGGGAGGAGACCTTTCGCTCTTTCTCTCCGCGTGGGGGTTCCGGGTCCCGGCAGGG

CGGCGCTGCAGCTGGGCGCGCAGGAAGG - UNI36255 - CTCGAGATGCAGCTGTGCAGAAAATTGAGACTATTATTAAGGAGCAGTTTGCTCTTGA

GATGAAGAATAAGGAACATGAGATTGATGTCATTGACCAG CGACTGATTGAAGCCAGGAGGATGATGGATAAGCTCCGGGCCTGCATTGTAGCAAACTA

TTATGCCTCCGCTGGTCTCCTGAAGGTTTCTGAG GGATTAAAGACATTTGATCCGATGGCTTTTAATCACCCTGCTATCAAGAAATTTTTGGAATCACC

TTCTAGGTCATCATCTCCTACCAATCAGAGATCAGAAACACCATCTGCCAATCACTCTGAAAGTGACTCTTTATCTCAGCACAATGACTTCCTGTCTGAC

AAAGACAATAACAGCAACGTGGATGTGGAGGAAAGACCCCCAAGCACCGGGGAACAGCGACCGAGCCGAAAGGCAGGAAGG GACACGTCTAGTATCAGT

GGCTCCCACAAACGGGAACTACGGAATGCTGACCTCACAGGAGATGAGACTTCACGACTGTTTGTCAAGAAAACGATAGTAGTCGGCAACGTGTCCAA -

 UNI34667 - GTACATACCTCCAGATAAGCGGGAAGAAAATGACCAGTCAACCCATAAGTGGATGGTATATGTCCGAGGGTCGCGTAGAGAGCCCAGC

ATTAATCACTTTGTCAAGAAAGTTTGGTTTTTCCTTCATCCTAGCTATAAACCAAACGATCTTGTGGAAGTTAG AGAGCCCCCCTTTCATCTGACTAGA

AGAGGCTGGGGTGAGTTTCCTGTCAGAGTGCAAGTTCACTTTAAGGACAGCCAGAACAAGCGGATAGATATCATACACAACCTGAAG CTGGATAGAACC

TACACTGGCCTACAGACCCTGGGTGCAGAGACG - UNI2827 - GTGGTGGACGTCGAGCTTCATCGGCACTCGCTTGGTGAAGACTCCGTTTATCCT

CAGTCGTCGGAATCAGACGTATGTGATGCCCCGCCTCCAACCCTGACGCTTCCAGCCGCCGTGAAAGCCTCAGCAGTGGCACAGTCCCCTGAGCCGGCAG

CTGCTGCCCCTGTGGGGGAAG - UNI36303 - GATTCCCAGAGACCACTGAAGCTGAGAGACACAGTACATTTTATTCTTTACCATCTTCGTTGGAA

AGAACACCCACTAAAGTGACAACAGCACAGAAGGTCACCTTCAGTTCACATGGGAATTCTGCCTTCCAGCCTATCGCATCAAGCTGCAAAATTGTGCCAC

AAAGTCAGGTGCCTAATCCCGAGTCACCTGGCAAGTCCTTTCAGCCAATCACCATGAGCTGTAAGATTGTCTCAG GTTCTCCAATATCAACTCCAAGCC

CATCACCATTACCTCGCACACCAACTTCCACTCCAGTTCATTTGAAGCAAGGCACTGCCAGTTCTGGTGTCAGCAACCCTCATGTTATTGTGGATAAGCC

TGGGCAGGTCATTGGAGCCTCCACTCCAAGTACAG - UNI33042 - GAAGTCCTACAAGCAAGCTCCCAGTGGCCTCTCAGGCTTCCCAAGGAACAG

GGTCCCCTATTCCTAAGATTCATGGAAGTAGTTTTTTGACATCTACTGTGAAG - UNI17032 - CAGGAGGAGTCTTTATTCGCATCTATGCCACCT

CTTTGCCCAATTGGTAGTCACCCTAAAGTGCAGAGCCCCAAAGCTGTGACTGGAGGACTTGGGGCTTTCACAAAG GTGATCATCAAACAGGAACCTGGA

GAAGCTCCTCATGTGTCCACAACAGGAGCTGCGAGCCAGTCAGCATTCCCTCAGTATGTGACCGTGAAAGGGGGTCACATGATAGCTGTGTCCCCTCAAA

AGCAGGTCATAAGTGCTGGAGAAGGGACCACTCAGTCACCAAAGATTGCACCCTCCAAG - UNI7927 - GTTGTTGGTGTGCCTGTTGGCTCTGCCT

TACCTTCCACAGTGAAGCAGGCTGTAGCAATCAGTAGTGGCCAAATCCTTGTCGCCAAGGCCAGCTCTTCTGTCACCAAAGCTGTTGGTCCAAAACAAGT

TGTGACCCAAGGAGTTGCCAAAGCAATCGTGAGTGGAGGTGGAGGGACCATTGTCGCTCAGCCAGTGCAGACCTTAACCAAGACTCAGGTCACAGCTGCT

GGGCCGCAGAAGAGTGGCTCCCAGGGCTCAG TAATGGCCACCTTGCAACTACCAGCCACTAATTTGGCCAACCTGGCGAACTTGCCTCCGGGCACTAAA

CTGTACCTTACCACGAACAGCAAGAACCCCTCAGGAAAAGGGAAGCTGCTGCTGATTCCTCAAGGAGCCATCCTGCGAGCTACCAACAATGCCA ACCTG

CAGTCTGGCTCGGCTGCTGCTGGTGGCAGTGGCAGCAGTGGTGCAGGGGGAGGCAGTGGAGGTGGCGGTGGCAGCGGAGCAGGAGGAACCCCAAGCACCT

CTGGCCCAGGAGGGGGCCCCCAGCACCTGACTTACACATCCTACATCCTCAAGCAAACCCCCCAG GGTACATTTTTAGTTGGCCAACCATCACCCCAAA

CACCTGGAAAACAACTGACTACTGCATCGGTGGTTCAAGGAACACTGGGAGTCAGTTCATCATCTGCACAGGGACAACAGACACTGAAAGTCATCTCTGG

ACAGAAAACCACTTTGTTTACACAG GCAGCCACTGCTGGGCAGGCATCGCTGCTGAAGTTACCAGACAACACCCTGAAGTCAGTGCCAGCAGCTCCACA

GCTCGCCAAGCCTGGGACCACGATGCTTCGAGTGGCAGGGGGGGTGATCACAGCTGCTCCCTCCCCTGCAGTGGCCTTCTCAGCAAATGGTGCTGTACAC

CAG TCTGAAGGATCAACCCCTGTGTCATCCTCTGTTGGTTCTATAATCAAAACTCCTGGTCAGCCACAAGTGTGTGTAAGCCAGGCCACCATGGCAACC

TGCAAGGGCCCCGCTGCTGTTGCCGGCACTGCCGCGTCCCTGGTATCTGCACCAAGCTCCATCTCTGGGAAAGCCACAGTGTCAG GGTTGCTAAAAGTT

CATTCCGCTCAGTCCAGTCCCCAGCAGGCTGTCCTGACAATTCCCAGTCAACTCAAGCCACTAAGCATCAATACCTCTGGTGGCGTGCAGACTGTCTTGA

TGCCTGTGAATAAAG TGGTTCAGTCGTTTTCTACCAGCAAATTACCTACTACTGTCCTGCCCATAAGTGTTCCAAATCAAGCTGCCCCCAGCTCTGCTC

CAGTAGCAATTGCCAAAG TGAAGACTGAACCAGAAACTCCTGGGCCAAACTGCATCTCACAGGAGAACCAGGTAGCAGTGAAAACAGAAGAGAGCTCTG

AGCTAAGCAACTACGTCATTAA GGTAGACCATTTGGAGACCATCCAGCAGCTCCTGACAGCAGTAGTGAAGAAGATCCCATTAATTACTGCAAAAG GT

GATGATGCCAGCTGTTTTTCTGCGAAGTCCTTGGAGCAGTATTACGGCTGGAACATTGGGAAGAGGAGAGCTGCTGAG TGGCAAAGAGCAATGACAGTA

CGAAAAGTGTTACAAGAAATCCTGGAGAAGAATCCAAGATTCCACCACTTGACTCCCCTCAAGACCAAGCACATTGCTCACTGGTGCCGCTGCCACGGTT

ACACCCCACCAGACCCCGAGAGCCTGCGACATGATGGAGACTCCATTGAGGATGTGCTGACCCAGATTGACAGTGAACCAG AGTGCCTGTCATCCTTCT

CCACTGCTGATGACCTCTGCCGGAAGCTGGAGGATCTGCAGCAGTTCCAGAAAAGGGAGCCTGAGAACGAGGAAGAAGTGGATATCCTCAGCCTGTCAGA

GCCACTGAAGACAAACATTAAAAAGGAGCAGGAAGAAAAGCAGGAAGAAATGAGATTCTACCTTCCACCAACCCCAGGCTCTGGATTTGTTGGTGACATT

ACACAGAAG ATTGGAATCACCCTGCAGCCTGTGGCGCTGCACAGGAACATGTATGCCTCAGTGGTAGAGGACATGATCTTAAAG GCCACGGAACAGCT

GGTGAGTGACATCCTGAGACAGGCACTGGCAGTTGGATACCAGACAGCATCTCCCAACAG GATTCCCAAAGAAATTACAGTGAGTAATATTCATCAGGC

CATTTGCAACATTCCTTTTCTGGATTTTCTTACAAACAAACACATGGGGAGACTGAATGAGGATCAGTGAATACAGCGAAGAGATCCCTGAAAAGCGGGA

GAGGCTGTGTCTGCAGTGTGCAGACTGTGACCCTCGTGTTTGAGGAAAGCTGGTGTTTTCTGTGTTGGAACGCCACGGTTGCCAGACCATTCCTTCCATC

TAACTGCGTATTACACAAGGGCATCGAGTTCCAGGTGCCCCCCTTTTAGGACAGAGTTGTTTCCCAATTCTGGAGGGAAGCTGAATGGACACGGCTTCGT

CAGTTTGCATTTCTTTACTCCCACAAGGCTCTGCGGGGTCTTGGTGTGAGACAAGGCACATGCACGGGGTGCTCGGTCCCTCTGTGGGCTGTGCGTGGGT

TCACCTGGGGCCTGCTTTTCAGAAGGCAAAGATAAGCCCGCCATGCTGGGCTGGGGAACTCTGAAGAAGACCAGCAACGAGTACCTTCTCCCGCCTTGCC

TCAGCGTAGAAGGGCTGCACTCTTGGCTGGTGTGAGTCAGCTACAGAGAAGGTAATACGCCATGTGGGAGGCCAAGGAGGCTGCAGTGAGACTCTTCCAC

GGAACCATGACGCTAGTGCAGTGACAGCCTGTGTCACGGCCGTGTTGAGGGGTCCCAGCAGAGGCCTGTGTCGTGTAACCCAGGGACTACAAGTGTCAGT

GTGGGTATCAACCTCAAAGTCAGGCACTTGAGCCATGTGTGGTCCTCCTCCATCTGGGATTCAGAAGCCCCTGCCACTGCCTCAGGTCAAGGGGAGGGAG

GCAGCCTCAGTGCAGACTTTATAGGATTGTCCTCTTGGTGGACCGGAGTCCTGTCCTTCTCTGCCAAAGAGTTTTACCAAGATGAAAAGGGTTGAAACAC

CTGTGAGTGCCTTACATGGGAAGAACTGCTCTAACCCACTGTGCTAATGTTCAGAAGCAGAGCCCTCAGTGAGAGCTGCACACACGAGCCTCTAGCATCA

CTACACAGTGTGCACACACTGGGGACTCCCCAGTCCTCCTGACTATTATGGGGACACAGGAAAGACCTCAGCCTCAGTTGTAAACCTGCTCTTTGTCTGC

TCAAAGGAAACTTGAAATATCTGAGTAAAAGTCAAAGAAACCCAGCTAAGTAAGCAACATAAAGCCTGTTGTGTCAGGTCCTGCAGGTCGATGTGTGAGT

CAGGAAACACTGCAGGGAAATAGACCTTTCCTTCCGTACCTGAGAGCTGCAGGTACCAAGGGATCTACCGTGCAGGGACTGGGCAAGCACAGCTTACTGC

TATAATTGGGTATATAAGGCTTAAGAATTTGGTCTATGCCAGGCGTGGTGGCGCATGCCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCGGATTTTT

GAGTTCAAGGGCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGGAACCCTGTCTCAAAAAAACAAAAAAAAAATAAAAACAAGA

ATTTGGTCTAAGACCATACAGCAGATTGATATGCTGGCACAGATTTGTTCAGAAGTGGACAGAGACTTACAAGGTAGAGTATCCCAATGAGAGCAGATTC

ATTTGTTGTGATAAAAAACCTAAAGAAATTACTTTTTTGCTAAAAAAAAAAAAATCAAATGATTTAACAGTTTCTGTGTATGTTAAACTTTCAAGTGTTT

TTTTAAATCATAATGTGTAATAATTGTGTATCATTTTGTCTACAATAAAACGTTTAGTATTTGCAATGGG
Translation
 - UNI36255 - MKNKEHEIDVIDQ RLIEARRMMDKLRACIVANYYASAGLLKVSE GLKTFDPMAFNHPAIKKFLESPSRSSSPTNQRSETPSANH

SESDSLSQHNDFLSDKDNNSNVDVEERPPSTGEQRPSRKAGR DTSSISGSHKRELRNADLTGDETSRLFVKKTIVVGNVSK - UNI34667 - KYIP

PDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVR REPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLK LDRTYTGLQ

TLGAET - UNI2827 - VVDVELHRHSLGEDSVYPQSSESDVCDAPPPTLTLPAAVKASAVAQSPEPAAAAPVGEG - UNI36303 - GFPETTEA

ERHSTFYSLPSSLERTPTKVTTAQKVTFSSHGNSAFQPIASSCKIVPQSQVPNPESPGKSFQPITMSCKIVSG GSPISTPSPSPLPRTPTSTPVHLKQG

TASSGVSNPHVIVDKPGQVIGASTPSTG - UNI33042 - GSPTSKLPVASQASQGTGSPIPKIHGSSFLTSTVK - UNI17032 - QEESLFASM

PPLCPIGSHPKVQSPKAVTGGLGAFTK VIIKQEPGEAPHVSTTGAASQSAFPQYVTVKGGHMIAVSPQKQVISAGEGTTQSPKIAPSK - UNI7927 

- VVGVPVGSALPSTVKQAVAISSGQILVAKASSSVTKAVGPKQVVTQGVAKAIVSGGGGTIVAQPVQTLTKTQVTAAGPQKSGSQGSV VMATLQLPAT

NLANLANLPPGTKLYLTTNSKNPSGKGKLLLIPQGAILRATNNAN NLQSGSAAAGGSGSSGAGGGSGGGGGSGAGGTPSTSGPGGGPQHLTYTSYILKQ

TPQ GTFLVGQPSPQTPGKQLTTASVVQGTLGVSSSSAQGQQTLKVISGQKTTLFTQ AATAGQASLLKLPDNTLKSVPAAPQLAKPGTTMLRVAGGVIT

AAPSPAVAFSANGAVHQ SEGSTPVSSSVGSIIKTPGQPQVCVSQATMATCKGPAAVAGTAASLVSAPSSISGKATVSG GLLKVHSAQSSPQQAVLTIP

SQLKPLSINTSGGVQTVLMPVNKV VVQSFSTSKLPTTVLPISVPNQAAPSSAPVAIAKV VKTEPETPGPNCISQENQVAVKTEESSELSNYVIK KVD

HLETIQQLLTAVVKKIPLITAKG GDDASCFSAKSLEQYYGWNIGKRRAAE WQRAMTVRKVLQEILEKNPRFHHLTPLKTKHIAHWCRCHGYTPPDPES

LRHDGDSIEDVLTQIDSEPE ECLSSFSTADDLCRKLEDLQQFQKREPENEEEVDILSLSEPLKTNIKKEQEEKQEEMRFYLPPTPGSGFVGDITQK IG

ITLQPVALHRNMYASVVEDMILK ATEQLVSDILRQALAVGYQTASPNR RIPKEITVSNIHQAICNIPFLDFLTNKHMGRLNEDQ
Transcript ENSMUST00000115560
Sequence
ATGTCTGGAATCAAGCGAACAATCAAAGAAACTGACCCTGATTATGAGGATGTATCTGTGGCCCTTCCAAATAAGCGGCATAAAGCGATTGAGAGTTCAG

 CTCGAGATGCAGCTGTGCAGAAAATTGAGACTATTATTAAGGAGCAGTTTGCTCTTGAGATGAAGAATAAGGAACATGAGATTGATGTCATTGACCAG 

CGACTGATTGAAGCCAGGAGGATGATGGATAAGCTCCGGGCCTGCATTGTAGCAAACTATTATGCCTCCGCTGGTCTCCTGAAGGTTTCTGAG GGATTA

AAGACATTTGATCCGATGGCTTTTAATCACCCTGCTATCAAGAAATTTTTGGAATCACCTTCTAGGTCATCATCTCCTACCAATCAGAGATCAGAAACAC

CATCTGCCAATCACTCTGAAAGTGACTCTTTATCTCAGCACAATGACTTCCTGTCTGACAAAGACAATAACAGCAACGTGGATGTGGAGGAAAGACCCCC

AAGCACCGGGGAACAGCGACCGAGCCGAAAGGCAGGAAGG GACACGTCTAGTATCAGTGGCTCCCACAAACGGGAACTACGGAATGCTGACCTCACAGG

AGATGAGACTTCACGACTGTTTGTCAAGAAAACGATAGTAGTCGGCAACGTGTCCAA - UNI34667 - GTACATACCTCCAGATAAGCGGGAAGAAA

ATGACCAGTCAACCCATAAGTGGATGGTATATGTCCGAGGGTCGCGTAGAGAGCCCAGCATTAATCACTTTGTCAAGAAAGTTTGGTTTTTCCTTCATCC

TAGCTATAAACCAAACGATCTTGTGGAAGTTAG AGAGCCCCCCTTTCATCTGACTAGAAGAGGCTGGGGTGAGTTTCCTGTCAGAGTGCAAGTTCACTT

TAAGGACAGCCAGAACAAGCGGATAGATATCATACACAACCTGAAG CTGGATAGAACCTACACTGGCCTACAGACCCTGGGTGCAGAGACG - UNI28

27 - GTGGTGGACGTCGAGCTTCATCGGCACTCGCTTGGTGAAGACTCCGTTTATCCTCAGTCGTCGGAATCAGACGTATGTGATGCCCCGCCTCCAAC

CCTGACGCTTCCAGCCGCCGTGAAAGCCTCAGCAGTGGCACAGTCCCCTGAGCCGGCAGCTGCTGCCCCTGTGGGGGAAG - UNI36303 - GATTCC

CAGAGACCACTGAAGCTGAGAGACACAGTACATTTTATTCTTTACCATCTTCGTTGGAAAGAACACCCACTAAAGTGACAACAGCACAGAAGGTCACCTT

CAGTTCACATGGGAATTCTGCCTTCCAGCCTATCGCATCAAGCTGCAAAATTGTGCCACAAAGTCAGGTGCCTAATCCCGAGTCACCTGGCAAGTCCTTT

CAGCCAATCACCATGAGCTGTAAGATTGTCTCAG GTTCTCCAATATCAACTCCAAGCCCATCACCATTACCTCGCACACCAACTTCCACTCCAGTTCAT

TTGAAGCAAGGCACTGCCAGTTCTGGTGTCAGCAACCCTCATGTTATTGTGGATAAGCCTGGGCAGGTCATTGGAGCCTCCACTCCAAGTACAG - UNI

33042 - GAAGTCCTACAAGCAAGCTCCCAGTGGCCTCTCAGGCTTCCCAAGGAACAGGGTCCCCTATTCCTAAGATTCATGGAAGTAGTTTTTTGACA

TCTACTGTGAAG - UNI17032 - CAGGAGGAGTCTTTATTCGCATCTATGCCACCTCTTTGCCCAATTGGTAGTCACCCTAAAGTGCAGAGCCCCAA

AGCTGTGACTGGAGGACTTGGGGCTTTCACAAAG GTGATCATCAAACAGGAACCTGGAGAAGCTCCTCATGTGTCCACAACAGGAGCTGCGAGCCAGTC

AGCATTCCCTCAGTATGTGACCGTGAAAGGGGGTCACATGATAGCTGTGTCCCCTCAAAAGCAGGTCATAAGTGCTGGAGAAGGGACCACTCAGTCACCA

AAGATTGCACCCTCCAAG - UNI7927 - GTTGTTGGTGTGCCTGTTGGCTCTGCCTTACCTTCCACAGTGAAGCAGGCTGTAGCAATCAGTAGTGGC

CAAATCCTTGTCGCCAAGGCCAGCTCTTCTGTCACCAAAGCTGTTGGTCCAAAACAAGTTGTGACCCAAGGAGTTGCCAAAGCAATCGTGAGTGGAGGTG

GAGGGACCATTGTCGCTCAGCCAGTGCAGACCTTAACCAAGACTCAGGTCACAGCTGCTGGGCCGCAGAAGAGTGGCTCCCAGGGCTCAG TAATGGCCA

CCTTGCAACTACCAGCCACTAATTTGGCCAACCTGGCGAACTTGCCTCCGGGCACTAAACTGTACCTTACCACGAACAGCAAGAACCCCTCAGGAAAAGG

GAAGCTGCTGCTGATTCCTCAAGGAGCCATCCTGCGAGCTACCAACAATGCCA ACCTGCAGTCTGGCTCGGCTGCTGCTGGTGGCAGTGGCAGCAGTGG

TGCAGGGGGAGGCAGTGGAGGTGGCGGTGGCAGCGGAGCAGGAGGAACCCCAAGCACCTCTGGCCCAGGAGGGGGCCCCCAGCACCTGACTTACACATCC

TACATCCTCAAGCAAACCCCCCAG GGTACATTTTTAGTTGGCCAACCATCACCCCAAACACCTGGAAAACAACTGACTACTGCATCGGTGGTTCAAGGA

ACACTGGGAGTCAGTTCATCATCTGCACAGGGACAACAGACACTGAAAGTCATCTCTGGACAGAAAACCACTTTGTTTACACAG GCAGCCACTGCTGGG

CAGGCATCGCTGCTGAAGTTACCAGACAACACCCTGAAGTCAGTGCCAGCAGCTCCACAGCTCGCCAAGCCTGGGACCACGATGCTTCGAGTGGCAGGGG

GGGTGATCACAGCTGCTCCCTCCCCTGCAGTGGCCTTCTCAGCAAATGGTGCTGTACACCAG TCTGAAGGATCAACCCCTGTGTCATCCTCTGTTGGTT

CTATAATCAAAACTCCTGGTCAGCCACAAGTGTGTGTAAGCCAGGCCACCATGGCAACCTGCAAGGGCCCCGCTGCTGTTGCCGGCACTGCCGCGTCCCT

GGTATCTGCACCAAGCTCCATCTCTGGGAAAGCCACAGTGTCAG GGTTGCTAAAAGTTCATTCCGCTCAGTCCAGTCCCCAGCAGGCTGTCCTGACAAT

TCCCAGTCAACTCAAGCCACTAAGCATCAATACCTCTGGTGGCGTGCAGACTGTCTTGATGCCTGTGAATAAAG TGGTTCAGTCGTTTTCTACCAGCAA

ATTACCTACTACTGTCCTGCCCATAAGTGTTCCAAATCAAGCTGCCCCCAGCTCTGCTCCAGTAGCAATTGCCAAAG TGAAGACTGAACCAGAAACTCC

TGGGCCAAACTGCATCTCACAGGAGAACCAGGTAGCAGTGAAAACAGAAGAGAGCTCTGAGCTAAGCAACTACGTCATTAA GGTAGACCATTTGGAGAC

CATCCAGCAGCTCCTGACAGCAGTAGTGAAGAAGATCCCATTAATTACTGCAAAAG GTGATGATGCCAGCTGTTTTTCTGCGAAGTCCTTGGAGCAGTA

TTACGGCTGGAACATTGGGAAGAGGAGAGCTGCTGAG TGGCAAAGAGCAATGACAGTACGAAAAGTGTTACAAGAAATCCTGGAGAAGAATCCAAGATT

CCACCACTTGACTCCCCTCAAGACCAAGCACATTGCTCACTGGTGCCGCTGCCACGGTTACACCCCACCAGACCCCGAGAGCCTGCGACATGATGGAGAC

TCCATTGAGGATGTGCTGACCCAGATTGACAGTGAACCAG AGTGCCTGTCATCCTTCTCCACTGCTGATGACCTCTGCCGGAAGCTGGAGGATCTGCAG

CAGTTCCAGAAAAGGGAGCCTGAGAACGAGGAAGAAGTGGATATCCTCAGCCTGTCAGAGCCACTGAAGACAAACATTAAAAAGGAGCAGGAAGAAAAGC

AGGAAGAAATGAGATTCTACCTTCCACCAACCCCAGGCTCTGGATTTGTTGGTGACATTACACAGAAG ATTGGAATCACCCTGCAGCCTGTGGCGCTGC

ACAGGAACATGTATGCCTCAGTGGTAGAGGACATGATCTTAAAG GCCACGGAACAGCTGGTGAGTGACATCCTGAGACAGGCACTGGCAGTTGGATACC

AGACAGCATCTCCCAACAG GATTCCCAAAGAAATTACAGTGAGTAATATTCATCAGGCCATTTGCAACATTCCTTTTCTGGATTTTCTTACAAACAAAC

ACATGGGGAGACTGAATGAGGATCAGTGAATACAGCGAAGAGATCCCTGAAAAGCGGGAGAGGCTGTGTCTGCAGTGTGCAGACTGTGACCCTCGTGTTT

GAGGAAAGCTGGTGTTTTCTGTGTTGGAACGCCACGGTTGCCAGACCATTCCTTCCATCTAACTGCGTATTACACAAGGGCATCGAGTTCCAGGTGCCCC

CCTTTTAGGACAGAGTTGTTTCCCAATTCTGGAGGGAAGCTGAATGGACACGGCTTCGTCAGTTTGCATTTCTTTACTCCCACAAGGCTCTGCGGGGTCT

TGGTGTGAGACAAGGCACATGCACGGGGTGCTCGGTCCCTCTGTGGGCTGTGCGTGGGTTCACCTGGGGCCTGCTTTTCAGAAGGCAAAGATAAGCCCGC

CATGCTGGGCTGGGGAACTCTGAAGAAGACCAGCAACGAGTACCTTCTCCCGCCTTGCCTCAGCGTAGAAGGGCTGCACTCTTGGCTGGTGTGAGTCAGC

TACAGAGAAGGTAATACGCCATGTGGGAGGCCAAGGAGGCTGCAGTGAGACTCTTCCACGGAACCATGACGCTAGTGCAGTGACAGCCTGTGTCACGGCC

GTGTTGAGGGGTCCCAGCAGAGGCCTGTGTCGTGTAACCCAGGGACTACAAGTGTCAGTGTGGGTATCAACCTCAAAGTCAGGCACTTGAGCCATGTGTG

GTCCTCCTCCATCTGGGATTCAGAAGCCCCTGCCACTGCCTCAGGTCAAGGGGAGGGAGGCAGCCTCAGTGCAGACTTTATAGGATTGTCCTCTTGGTGG

ACCGGAGTCCTGTCCTTCTCTGCCAAAGAGTTTTACCAAGATGAAAAGGGTTGAAACACCTGTGAGTGCCTTACATGGGAAGAACTGCTCTAACCCACTG

TGCTAATGTTCAGAAGCAGAGCCCTCAGTGAGAGCTGCACACACGAGCCTCTAGCATCACTACACAGTGTGCACACACTGGGGACTCCCCAGTCCTCCTG

ACTATTATGGGGACACAGGAAAGACCTCAGCCTCAGTTGTAAACCTGCTCTTTGTCTGCTCAAAGGAAACTTGAAATATCTGAGTAAAAGTCAAAGAAAC

CCAGCTAAGTAAGCAACATAAAGCCTGTTGTGTCAGGTCCTGCAGGTCGATGTGTGAGTCAGGAAACACTGCAGGGAAATAGACCTTTCCTTCCGTACCT

GAGAGCTGCAGGTACCAAGGGATCTACCGTGCAGGGACTGGGCAAGCACAGCTTACTGCTATAATTGGGTATATAAGGCTTAAGAATTTGGTCTATGCCA

GGCGTGGTGGCGCATGCCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCGGATTTTTGAGTTCAAGGGCAGCCTGGTCTACAAAGTGAGTTCCAGGAC

AGCCAGGGCTACACAGAGGAACCCTGTCTCAAAAAAACAAAAAAAAAATAAAAACAAGAATTTGGTCTAAGACCATACAGCAGATTGATATGCTGGCACA

GATTTGTTCAGAAGTGGACAGAGACTTACAAGGTAGAGTATCCCAATGAGAGCAGATTCATTTGTTGTGATAAAAAACCTAAAGAAATTACTTTTTTGCT

AAAAAAAAAAAAATCAAATGATTTAACAGTTTCTGTGTATGTTAAACTTTCAAGTGTTTTTTTAAATCATAATGTGTAATAATTGTGTATCATTTTGTCT

ACAATAAAACGTTTAGTATTTGCAATGGG
Translation
MSGIKRTIKETDPDYEDVSVALPNKRHKAIESSA ARDAAVQKIETIIKEQFALEMKNKEHEIDVIDQ RLIEARRMMDKLRACIVANYYASAGLLKVSE

 GLKTFDPMAFNHPAIKKFLESPSRSSSPTNQRSETPSANHSESDSLSQHNDFLSDKDNNSNVDVEERPPSTGEQRPSRKAGR DTSSISGSHKRELRNA

DLTGDETSRLFVKKTIVVGNVSK - UNI34667 - KYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVR REPPFHL

TRRGWGEFPVRVQVHFKDSQNKRIDIIHNLK LDRTYTGLQTLGAET - UNI2827 - VVDVELHRHSLGEDSVYPQSSESDVCDAPPPTLTLPAAVK

ASAVAQSPEPAAAAPVGEG - UNI36303 - GFPETTEAERHSTFYSLPSSLERTPTKVTTAQKVTFSSHGNSAFQPIASSCKIVPQSQVPNPESPGK

SFQPITMSCKIVSG GSPISTPSPSPLPRTPTSTPVHLKQGTASSGVSNPHVIVDKPGQVIGASTPSTG - UNI33042 - GSPTSKLPVASQASQGT

GSPIPKIHGSSFLTSTVK - UNI17032 - QEESLFASMPPLCPIGSHPKVQSPKAVTGGLGAFTK VIIKQEPGEAPHVSTTGAASQSAFPQYVTVK

GGHMIAVSPQKQVISAGEGTTQSPKIAPSK - UNI7927 - VVGVPVGSALPSTVKQAVAISSGQILVAKASSSVTKAVGPKQVVTQGVAKAIVSGGG

GTIVAQPVQTLTKTQVTAAGPQKSGSQGSV VMATLQLPATNLANLANLPPGTKLYLTTNSKNPSGKGKLLLIPQGAILRATNNAN NLQSGSAAAGGSG

SSGAGGGSGGGGGSGAGGTPSTSGPGGGPQHLTYTSYILKQTPQ GTFLVGQPSPQTPGKQLTTASVVQGTLGVSSSSAQGQQTLKVISGQKTTLFTQ A

ATAGQASLLKLPDNTLKSVPAAPQLAKPGTTMLRVAGGVITAAPSPAVAFSANGAVHQ SEGSTPVSSSVGSIIKTPGQPQVCVSQATMATCKGPAAVAG

TAASLVSAPSSISGKATVSG GLLKVHSAQSSPQQAVLTIPSQLKPLSINTSGGVQTVLMPVNKV VVQSFSTSKLPTTVLPISVPNQAAPSSAPVAIAK

V VKTEPETPGPNCISQENQVAVKTEESSELSNYVIK KVDHLETIQQLLTAVVKKIPLITAKG GDDASCFSAKSLEQYYGWNIGKRRAAE WQRAMTV

RKVLQEILEKNPRFHHLTPLKTKHIAHWCRCHGYTPPDPESLRHDGDSIEDVLTQIDSEPE ECLSSFSTADDLCRKLEDLQQFQKREPENEEEVDILSL

SEPLKTNIKKEQEEKQEEMRFYLPPTPGSGFVGDITQK IGITLQPVALHRNMYASVVEDMILK ATEQLVSDILRQALAVGYQTASPNR RIPKEITVS

NIHQAICNIPFLDFLTNKHMGRLNEDQ
Transcript ENSMUST00000041176
Sequence
ATGTCTGGAATCAAGCGAACAATCAAAGAAACTGACCCTGATTATGAGGATGTATCTGTGGCCCTTCCAAATAAGCGGCATAAAGCGATTGAGAGTTCAG

 CTCGAGATGCAGCTGTGCAGAAAATTGAGACTATTATTAAGGAGCAGTTTGCTCTTGAGATGAAGAATAAGGAACATGAGATTGATGTCATTGACCAG 

CGACTGATTGAAGCCAGGAGGATGATGGATAAGCTCCGGGCCTGCATTGTAGCAAACTATTATGCCTCCGCTGGTCTCCTGAAGGTTTCTGAG GGATTA

AAGACATTTGATCCGATGGCTTTTAATCACCCTGCTATCAAGAAATTTTTGGAATCACCTTCTAGGTCATCATCTCCTACCAATCAGAGATCAGAAACAC

CATCTGCCAATCACTCTGAAAGTGACTCTTTATCTCAGCACAATGACTTCCTGTCTGACAAAGACAATAACAGCAACGTGGATGTGGAGGAAAGACCCCC

AAGCACCGGGGAACAGCGACCGAGCCGAAAGGCAGGAAGG GACACGTCTAGTATCAGTGGCTCCCACAAACGGGAACTACGGAATGCTGACCTCACAGG

AGATGAGACTTCACGACTGTTTGTCAAGAAAACGATAGTAGTCGGCAACGTGTCCAA - UNI34667 - GTACATACCTCCAGATAAGCGGGAAGAAA

ATGACCAGTCAACCCATAAGTGGATGGTATATGTCCGAGGGTCGCGTAGAGAGCCCAGCATTAATCACTTTGTCAAGAAAGTTTGGTTTTTCCTTCATCC

TAGCTATAAACCAAACGATCTTGTGGAAGTTAG AGAGCCCCCCTTTCATCTGACTAGAAGAGGCTGGGGTGAGTTTCCTGTCAGAGTGCAAGTTCACTT

TAAGGACAGCCAGAACAAGCGGATAGATATCATACACAACCTGAAG CTGGATAGAACCTACACTGGCCTACAGACCCTGGGTGCAGAGACG - UNI28

27 - GTGGTGGACGTCGAGCTTCATCGGCACTCGCTTGGTGAAGACTCCGTTTATCCTCAGTCGTCGGAATCAGACGTATGTGATGCCCCGCCTCCAAC

CCTGACGCTTCCAGCCGCCGTGAAAGCCTCAGCAGTGGCACAGTCCCCTGAGCCGGCAGCTGCTGCCCCTGTGGGGGAAG - UNI36303 - GATTCC

CAGAGACCACTGAAGCTGAGAGACACAGTACATTTTATTCTTTACCATCTTCGTTGGAAAGAACACCCACTAAAGTGACAACAGCACAGAAGGTCACCTT

CAGTTCACATGGGAATTCTGCCTTCCAGCCTATCGCATCAAGCTGCAAAATTGTGCCACAAAGTCAGGTGCCTAATCCCGAGTCACCTGGCAAGTCCTTT

CAGCCAATCACCATGAGCTGTAAGATTGTCTCAG GTTCTCCAATATCAACTCCAAGCCCATCACCATTACCTCGCACACCAACTTCCACTCCAGTTCAT

TTGAAGCAAGGCACTGCCAGTTCTGGTGTCAGCAACCCTCATGTTATTGTGGATAAGCCTGGGCAGGTCATTGGAGCCTCCACTCCAAGTACAG - UNI

33042 - GAAGTCCTACAAGCAAGCTCCCAGTGGCCTCTCAGGCTTCCCAAGGAACAGGGTCCCCTATTCCTAAGATTCATGGAAGTAGTTTTTTGACA

TCTACTGTGAAG - UNI17032 - CAGGAGGAGTCTTTATTCGCATCTATGCCACCTCTTTGCCCAATTGGTAGTCACCCTAAAGTGCAGAGCCCCAA

AGCTGTGACTGGAGGACTTGGGGCTTTCACAAAG GTGATCATCAAACAGGAACCTGGAGAAGCTCCTCATGTGTCCACAACAGGAGCTGCGAGCCAGTC

AGCATTCCCTCAGTATGTGACCGTGAAAGGGGGTCACATGATAGCTGTGTCCCCTCAAAAGCAGGTCATAAGTGCTGGAGAAGGGACCACTCAGTCACCA

AAGATTGCACCCTCCAAG - UNI7927 - GTTGTTGGTGTGCCTGTTGGCTCTGCCTTACCTTCCACAGTGAAGCAGGCTGTAGCAATCAGTAGTGGC

CAAATCCTTGTCGCCAAGGCCAGCTCTTCTGTCACCAAAGCTGTTGGTCCAAAACAAGTTGTGACCCAAGGAGTTGCCAAAGCAATCGTGAGTGGAGGTG

GAGGGACCATTGTCGCTCAGCCAGTGCAGACCTTAACCAAGACTCAGGTCACAGCTGCTGGGCCGCAGAAGAGTGGCTCCCAGGGCTCAG TAATGGCCA

CCTTGCAACTACCAGCCACTAATTTGGCCAACCTGGCGAACTTGCCTCCGGGCACTAAACTGTACCTTACCACGAACAGCAAGAACCCCTCAGGAAAAGG

GAAGCTGCTGCTGATTCCTCAAGGAGCCATCCTGCGAGCTACCAACAATGCCA ACCTGCAGTCTGGCTCGGCTGCTGCTGGTGGCAGTGGCAGCAGTGG

TGCAGGGGGAGGCAGTGGAGGTGGCGGTGGCAGCGGAGCAGGAGGAACCCCAAGCACCTCTGGCCCAGGAGGGGGCCCCCAGCACCTGACTTACACATCC

TACATCCTCAAGCAAACCCCCCAG GGTACATTTTTAGTTGGCCAACCATCACCCCAAACACCTGGAAAACAACTGACTACTGCATCGGTGGTTCAAGGA

ACACTGGGAGTCAGTTCATCATCTGCACAGGGACAACAGACACTGAAAGTCATCTCTGGACAGAAAACCACTTTGTTTACACAG GCAGCCACTGCTGGG

CAGGCATCGCTGCTGAAGTTACCAGACAACACCCTGAAGTCAGTGCCAGCAGCTCCACAGCTCGCCAAGCCTGGGACCACGATGCTTCGAGTGGCAGGGG

GGGTGATCACAGCTGCTCCCTCCCCTGCAGTGGCCTTCTCAGCAAATGGTGCTGTACACCAG TCTGAAGGATCAACCCCTGTGTCATCCTCTGTTGGTT

CTATAATCAAAACTCCTGGTCAGCCACAAGTGTGTGTAAGCCAGGCCACCATGGCAACCTGCAAGGGCCCCGCTGCTGTTGCCGGCACTGCCGCGTCCCT

GGTATCTGCACCAAGCTCCATCTCTGGGAAAGCCACAGTGTCAG GGTTGCTAAAAGTTCATTCCGCTCAGTCCAGTCCCCAGCAGGCTGTCCTGACAAT

TCCCAGTCAACTCAAGCCACTAAGCATCAATACCTCTGGTGGCGTGCAGACTGTCTTGATGCCTGTGAATAAAG TGGTTCAGTCGTTTTCTACCAGCAA

ATTACCTACTACTGTCCTGCCCATAAGTGTTCCAAATCAAGCTGCCCCCAGCTCTGCTCCAGTAGCAATTGCCAAAG TGAAGACTGAACCAGAAACTCC

TGGGCCAAACTGCATCTCACAGGAGAACCAGGTAGCAGTGAAAACAGAAGAGAGCTCTGAGCTAAGCAACTACGTCATTAA GGTAGACCATTTGGAGAC

CATCCAGCAGCTCCTGACAGCAGTAGTGAAGAAGATCCCATTAATTACTGCAAAAG GTGATGATGCCAGCTGTTTTTCTGCGAAGTCCTTGGAGCAGTA

TTACGGCTGGAACATTGGGAAGAGGAGAGCTGCTGAG TGGCAAAGAGCAATGACAGTACGAAAAGTGTTACAAGAAATCCTGGAGAAGAATCCAAGATT

CCACCACTTGACTCCCCTCAAGACCAAGCACATTGCTCACTGGTGCCGCTGCCACGGTTACACCCCACCAGACCCCGAGAGCCTGCGACATGATGGAGAC

TCCATTGAGGATGTGCTGACCCAGATTGACAGTGAACCAG AGTGCCTGTCATCCTTCTCCACTGCTGATGACCTCTGCCGGAAGCTGGAGGATCTGCAG

CAGTTCCAGAAAAGGGAGCCTGAGAACGAGGAAGAAGTGGATATCCTCAGCCTGTCAGAGCCACTGAAG ACCTCAGCCTCAGTTGTAAACCTGCTCTTT

GTCTGCTCAAAGGAAACTTGAAATATCTGAGTAAAAGTCAAAGAAACCCAGCTAAGTAAGCAACATAAAGCCTGTTGTGTCAGGTCCTGCAGGTCGATGT

GTGAGTCAGGAAACACTGCAGGGAAATAGACCTTTCCTTCCGTACCTGAGAGCTGCAGGTACCAAGGGATCTACCGTGCAGGGACTGGGCAAGCACAGCT

TACTGCTATAATTGGGTATATAAGGCTTAAGAATTTGGTCTATGCCAGGCGTGGTGGCGCATGCCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCGG

ATTTTTGAGTTCAAGGGCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGGAACCCTGTCTC
Translation
MSGIKRTIKETDPDYEDVSVALPNKRHKAIESSA ARDAAVQKIETIIKEQFALEMKNKEHEIDVIDQ RLIEARRMMDKLRACIVANYYASAGLLKVSE

 GLKTFDPMAFNHPAIKKFLESPSRSSSPTNQRSETPSANHSESDSLSQHNDFLSDKDNNSNVDVEERPPSTGEQRPSRKAGR DTSSISGSHKRELRNA

DLTGDETSRLFVKKTIVVGNVSK - UNI34667 - KYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVR REPPFHL

TRRGWGEFPVRVQVHFKDSQNKRIDIIHNLK LDRTYTGLQTLGAET - UNI2827 - VVDVELHRHSLGEDSVYPQSSESDVCDAPPPTLTLPAAVK

ASAVAQSPEPAAAAPVGEG - UNI36303 - GFPETTEAERHSTFYSLPSSLERTPTKVTTAQKVTFSSHGNSAFQPIASSCKIVPQSQVPNPESPGK

SFQPITMSCKIVSG GSPISTPSPSPLPRTPTSTPVHLKQGTASSGVSNPHVIVDKPGQVIGASTPSTG - UNI33042 - GSPTSKLPVASQASQGT

GSPIPKIHGSSFLTSTVK - UNI17032 - QEESLFASMPPLCPIGSHPKVQSPKAVTGGLGAFTK VIIKQEPGEAPHVSTTGAASQSAFPQYVTVK

GGHMIAVSPQKQVISAGEGTTQSPKIAPSK - UNI7927 - VVGVPVGSALPSTVKQAVAISSGQILVAKASSSVTKAVGPKQVVTQGVAKAIVSGGG

GTIVAQPVQTLTKTQVTAAGPQKSGSQGSV VMATLQLPATNLANLANLPPGTKLYLTTNSKNPSGKGKLLLIPQGAILRATNNAN NLQSGSAAAGGSG

SSGAGGGSGGGGGSGAGGTPSTSGPGGGPQHLTYTSYILKQTPQ GTFLVGQPSPQTPGKQLTTASVVQGTLGVSSSSAQGQQTLKVISGQKTTLFTQ A

ATAGQASLLKLPDNTLKSVPAAPQLAKPGTTMLRVAGGVITAAPSPAVAFSANGAVHQ SEGSTPVSSSVGSIIKTPGQPQVCVSQATMATCKGPAAVAG

TAASLVSAPSSISGKATVSG GLLKVHSAQSSPQQAVLTIPSQLKPLSINTSGGVQTVLMPVNKV VVQSFSTSKLPTTVLPISVPNQAAPSSAPVAIAK

V VKTEPETPGPNCISQENQVAVKTEESSELSNYVIK KVDHLETIQQLLTAVVKKIPLITAKG GDDASCFSAKSLEQYYGWNIGKRRAAE WQRAMTV

RKVLQEILEKNPRFHHLTPLKTKHIAHWCRCHGYTPPDPESLRHDGDSIEDVLTQIDSEPE ECLSSFSTADDLCRKLEDLQQFQKREPENEEEVDILSL

SEPLK TSASVVNLLFVCSKET

For any suggestions or comments, please send an email to unitrap@crg.es