Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041216 (Rlbp1l1)
Chromosomal location
Chr 4: 9196509 - 9378838 (+)
Description
retinaldehyde binding protein 1-like 1 Gene [Source:MGI (curated);Acc:Rlbp1l1-001]
RefSeq_dna
NM_028940 
RefSeq_peptide
NP_083216.1 
MGI
MGI:1921688 
Uniprot/SWISSPROT
Q9D4C9 
Human Ortholog
ENSG00000177182 (RLBP1L1)
Omim not available
UniTrap UNI34114
Vector Insertion
Chr 4: 9198679 - 9208534
Public Clones IST14885E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108348
Sequence
CACCAGAAACACAGGCCCCGAATGCAAAGCATCCAAAGACGCTGTCTTCCTGTACTTAATGCAATTTCCTGAGGCTG - UNI34115 - TAAGCAATG

GCTTCGGTTTCCCTCCTCTTTTGGATGGCCACCACCACATAGGGCCTGAATGTCCTGCTGTTCTCCAAGGACAGAAAGAAGACTCTGTACCCGTCTGTTT

GGGGAGCAGTCTTGTAGGGGAGCCATCGAATGGGCCACGGATTCAGCACACTTCCATGTGAATGGGACCAGTTTCTGTTCTTCCCTCACCTCAGAGCTTA

AGCACTTGGGAAGGAGATTTGGCCAAGATGACGCATTTGCAGGCTGGGCTCAGTCCAGACACTATAGAAAAAGCTCGTCTGGAACTGAATGAAAACCCAG

ATATTTTACATCAGGACATTCAACAAGTCAGAGACATGATCATCACCAGACCAGACATTGGGTTTTTACGTACAGATGATGCCTTCATTCTGCGATTTCT

TCGAGCCAGGAAGTTTCACCAAGCCGATGCCTTCAGACTCCTGGCCCAGTACTTTCAGTACCGCCAGCTGAACCTGGACATGTTCAAAAACTTTAAGGCA

GATGATCCCGGGATTAAGAGGGCTTTGATCGACGGATTCCCCGGAGTGCTGGAAAATCGTGACCACTATGGCAGGAAGATTCTCTTGCTGTTTGCTGCCA

ATTGGGATCAGAGTAG GAACTCCTTCACGGACATCCTCCGTGCCATTCTCCTGTCCTTGGAAGTCCTTATTGAAGATCCCGAGCTCCAGATAAACGGTT

TCATTTTAATTATAGACTGGAGCAACTTTTCCTTCAAGCAAGCATCCAAGCTGACACCCTCTATCCTGAAACTGGCCATTGAAGGGCTGCAG GACAGCT

TTCCTGCTCGCTTTGGAGGCGTCCATTTTGTCAACCAGCCCTGGTACATCCACGCCCTGTACACACTCATCAAGCCATTCCTTAAGGACAAGACAAGAAA

ACGG ATTTTCCTACATGGAAACAATTTAAACAGTCTTCACCAGCTAATACACCCCGAGTTCCTGCCCTCTGAATTTGGAGGAACCCTTCCTCCTTACGA

CATGGGGACTTGGGCCCGGACATTACTTGGCCCTGACTACAGCGATGAAAATGACTATACCCATACTTCCTACAATGCCATGCATGTGAAACACACCTGT

TCCAACCTGGAGAGAGAGTGCTCACCCAAGCCCATGAAAAG ATCTCAGTCTGTGGTAGAAGCTGGGACCTTGAAACATGAAGAGAAAGGAGAAAATGAG

AACACCCAGCCACTGCTGGCTCTGGACTGAGCCAGCCAGCATCATGTGACATCTCCAGTGGAGCAACCGTCCAGCAAGCCTGTGCAACTGACCTACAGAC

ACTCTGTGTGCTCTGCTTGACATGAGGTCCTCCATCCCAGTCCCAGCCATGACTGTCAGCAACCATTGGTCTGGGTAGCCCACACCGGACAAAGATCTGA

GAGACGCTTTTAAAAATTTAACGAATTAATTTATGTTTTAGTGAGGAATGGTGACGGGGATGAAGAAAGGCATTTATGTAAAAAGGATTCTCCCCTCATA

TTTTTGGCAGCAAATATACTTCAAAAGGGGAAAAAAACCCTAAATTAGTTGCATATACATCACTCTAAAGACTCACACAGGAACCCTCTCCAGGTTTTGC

AAATTAAGATGAAATGCATTCCGAAATAAATAAAACAGAGTTAAAATGTGCAGACACATCAGCAAGTTTAATGTAGTGCTGAACCCCAGCAGCAGTAGCT

CCAATAATTTCCAGTCCTATTGACTTATTTCCTGACCTCATCACCAGCATCTAAGTAGTCAGCCTAAGAGTGTGATCTCCCACGTCTGGCTATTTGCAAA

GTTTTTCATTTAAATCTCTCTCCTACAAGAATGATTTGGACATCGTGTTGCTTGTCAGACCATCAGCTGACTTTCATGAATTGCTTTTTAAGACAAAGAG

GCAGTTTGAAAAAAAAAGAGGCTGCTTCATTGTAGCAAAGTGATTTCCTGTAGGCGAATGCCTACAGAGAGGGGGCAACTCATTGGAACACACACCACAC

ACCACACACACACACACACACACACTGGTGACTGATTACCCTTTTAAGTTAATTCTTGGGTTACTACAGCAAAAACTTGCTATCAAATAAGTCCCTTTGT

CCCCATGCTCCTATTACCTGTGGAGAAAGGCCCTGAGGGGGCAGGCATTCAAATCTCACAGAAAGACCCTTAAGGATGGATCAGCATGTAAGTACCAAGC

TAAAGAGGACCAAGAATGCAAGATGAAATGCCAAAGACCAGCCTACTTCCTTATCCATTCTCCTTAGAAATGGATCCCAGCCCCCATGCATAGGAAGTCA

GACAGAGAACAGCAAAGGGGAGGATATTTTATCTGTGCCATGTTTCCTGAGACCAGCTGAGTATGTGTAGATACCTTATTCTCTAGCATCTGTACGACAC

AGACACTTACTAATATGACCAGAGTGATAATGTCAAAATTTTTAATTGCTAACACTTATTAAAATACTTTACATTTTAAGCACTTGGTAGAGTGATTTAC

TAGCTGAACAGCCTAAAGAAAAGAGGAAACCAATTCAACTTACTTCCCGCCATAAACACAAAACATTACTGACTATGGCCACTTCCCTCTCTCCATCTCT

CTCTTTCCCTGTTCCTTCCCACTTCTCTCCTCCTTACACTCCTCTCCTTTTCCTTTGTCTTTCTTTCTCTGTCTCCCTGTTACCCTCTCTTCTCTGTCTC

CCTCCAATGCTGAAGATCAAACCCAGGGCCTAACCCCTGAGCCCTGAGCTACAAACTAGATGTATACTCCTCAGTTGATCTACTGTTTTATTATTTTTTT

CTACTGGCAGAGAATAGTAACAGAAGCTATTTTTATGTTCCAACCTTGAAGAAGCAAAATTGAAACAGAATTTTAAAATATTTCCCAAACAATTGCATCA

TAGTATATTAAAAAAAAAACCCTACCAATTCATTTTGTATAGACCTTTAGAATTGTAAAATAATAACCTTGAAAAATGTTTACCAAGACATGGATGGAAA

TTCTTTTCTTATGACACAAGTAAGAGCGAGGAAAAATTAAAGTGAATTAGAAAATCTTTTATTGCTTGTGTTTATAAGATCAACGTGGGATCCAAGTACT

TAAAATGCTGTTGGAGTGCACCACTGCCAACACTTGCAAAAGTAACGGTACTGCTGGCTTTTCACAAGGCAAGATTTAGAATCCTACTGTAATGACCATA

TTTTAAAAAACATGTTATATTTACTAAGTTAACAGCTAATTTTCACTCATTTCCTCCATTTTATTCCATGGATGTAAGGTGATAGTTTAACAATGAGAAC

ACATGGTTTGCATTTCGCTATGTATATGTAGTATAGAGGAGAACTAAACCCAGCAGGTAACCGAGGGTTACTACATGAACACTGGATTGTATTGCCTTTG

TCAGTAAGTTCCTCTGTTTAATAAATACTGAAGAACACAAATAA
Translation
 - UNI34115 - MGPVSVLPSPQSLSTWEGDLAKMTHLQAGLSPDTIEKARLELNENPDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFH

QADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSR RNSFTDILRAILLSLEVLIEDPELQINGFILII

DWSNFSFKQASKLTPSILKLAIEGLQ DSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKR IFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGT

WARTLLGPDYSDENDYTHTSYNAMHVKHTCSNLERECSPKPMKR RSQSVVEAGTLKHEEKGENENTQPLLALD
Transcript ENSMUST00000038841
Sequence
GAGAAATCTGAGCTCCAACTGCCAGGGTAGGGGATCTCACCCACCCAGTTCAGCCGCGAGGACACCTGCAGAAACACATTCTCAAAGCAAGCCTGGGAGG

CGGTGTGAAG - UNI34115 - TAAGCAATGGCTTCGGTTTCCCTCCTCTTTTGGATGGCCACCACCACATAGGGCCTGAATGTCCTGCTGTTCTCCA

AGGACAGAAAGAAGACTCTGTACCCGTCTGTTTGGGGAGCAGTCTTGTAGGGGAGCCATCGAATGGGCCACGGATTCAGCACACTTCCATGTGAATGGGA

CCAGTTTCTGTTCTTCCCTCACCTCAGAGCTTAAGCACTTGGGAAGGAGATTTGGCCAAGATGACGCATTTGCAGGCTGGGCTCAGTCCAGACACTATAG

AAAAAGCTCGTCTGGAACTGAATGAAAACCCAGATATTTTACATCAGGACATTCAACAAGTCAGAGACATGATCATCACCAGACCAGACATTGGGTTTTT

ACGTACAGATGATGCCTTCATTCTGCGATTTCTTCGAGCCAGGAAGTTTCACCAAGCCGATGCCTTCAGACTCCTGGCCCAGTACTTTCAGTACCGCCAG

CTGAACCTGGACATGTTCAAAAACTTTAAGGCAGATGATCCCGGGATTAAGAGGGCTTTGATCGACGGATTCCCCGGAGTGCTGGAAAATCGTGACCACT

ATGGCAGGAAGATTCTCTTGCTGTTTGCTGCCAATTGGGATCAGAGTAG GAACTCCTTCACGGACATCCTCCGTGCCATTCTCCTGTCCTTGGAAGTCC

TTATTGAAGATCCCGAGCTCCAGATAAACGGTTTCATTTTAATTATAGACTGGAGCAACTTTTCCTTCAAGCAAGCATCCAAGCTGACACCCTCTATCCT

GAAACTGGCCATTGAAGGGCTGCAG GACAGCTTTCCTGCTCGCTTTGGAGGCGTCCATTTTGTCAACCAGCCCTGGTACATCCACGCCCTGTACACACT

CATCAAGCCATTCCTTAAGGACAAGACAAGAAAACGG ATTTTCCTACATGGAAACAATTTAAACAGTCTTCACCAGCTAATACACCCCGAGTTCCTGCC

CTCTGAATTTGGAGGAACCCTTCCTCCTTACGACATGGGGACTTGGGCCCGGACATTACTTGGCCCTGACTACAGCGATGAAAATGACTATACCCATACT

TCCTACAATGCCATGCATGTGAAACACACCTGTTCCAACCTGGAGAGAGAGTGCTCACCCAAGCCCATGAAAAG ATCTCAGTCTGTGGTAGAAGCTGGG

ACCTTGAAACATGAAGAGAAAGGAGAAAATGAGAACACCCAGCCACTGCTGGCTCTGGACTGAGCCAGCCAGCATCATGTGACATCTCCAGTGGAGCAAC

CGTCCAGCAAGCCTGTGCAACTGACCTACAGACACTCTGTGTGCTCTGCTTGACATGAGGTCCTCCATCCCAGTCCCAGCCATGACTGTCAGCAACCATT

GGTCTGGGTAGCCCACACCGGACAAAGATCTGAGAGACGCTTTTAAAAATTTAACGAATTAATTTATGTTTTAGTGAGGAATGGTGACGGGGATGAAGAA

AGGCATTTATGTAAAAAGGATTCTCCCCTCATATTTTTGGCAGCAAATATACTTCAAAAGGGGAAAAAAACCCTAAATTAGTTGCATATACATCACTCTA

AAGACTCACACAGGAACCCTCTCCAGGTTTTGCAAATTAAGATGAAATGCATTCCGAAATAAATAAAACAGAGTTAAAATGTGCAGACACATCAGCAAGT

TTAATGTAGTGCTGAACCCCAGCAGCAGTAGCTCCAATAATTTCCAGTCCTATTGACTTATTTCCTGACCTCATCACCAGCATCTAAGTAGTCAGCCTAA

GAGTGTGATCTCCCACGTCTGGCTATTTGCAAAGTTTTTCATTTAAATCTCTCTCCTACAAGAATGATTTGGACATCGTGTTGCTTGTCAGACCATCAGC

TGACTTTCATGAATTGCTTTTTAAGACAAAGAGGCAGTTTGAAAAAAAAAGAGGCTGCTTCATTGTAGCAAAGTGATTTCCTGTAGGCGAATGCCTACAG

AGAGGGGGCAACTCATTGGAACACACACCACACACCACACACACACACACACACACACTGGTGACTGATTACCCTTTTAAGTTAATTCTTGGGTTACTAC

AGCAAAAACTTGCTATCAAATAAGTCCCTTTGTCCCCATGCTCCTATTACCTGTGGAGAAAGGCCCTGAGGGGGCAGGCATTCAAATCTCACAGAAAGAC

CCTTAAGGATGGATCAGCATGTAAGTACCAAGCTAAAGAGGACCAAGAATGCAAGATGAAATGCCAAAGACCAGCCTACTTCCTTATCCATTCTCCTTAG

AAATGGATCCCAGCCCCCATGCATAGGAAGTCAGACAGAGAACAGCAAAGGGGAGGATATTTTATCTGTGCCATGTTTCCTGAGACCAGCTGAGTATGTG

TAGATACCTTATTCTCTAGCATCTGTACGACACAGACACTTACTAATATGACCAGAGTGATAATGTCAAAATTTTTAATTGCTAACACTTATTAAAATAC

TTTACATTTTAAGCACTTGGTAGAGTGATTTACTAGCTGAACAGCCTAAAGAAAAGAGGAAACCAATTCAACTTACTTCCCGCCATAAACACAAAACATT

ACTGACTATGGCCACTTCCCTCTCTCCATCTCTCTCTTTCCCTGTTCCTTCCCACTTCTCTCCTCCTTACACTCCTCTCCTTTTCCTTTGTCTTTCTTTC

TCTGTCTCCCTGTTACCCTCTCTTCTCTGTCTCCCTCCAATGCTGAAGATCAAACCCAGGGCCTAACCCCTGAGCCCTGAGCTACAAACTAGATGTATAC

TCCTCAGTTGATCTACTGTTTTATTATTTTTTTCTACTGGCAGAGAATAGTAACAGAAGCTATTTTTATGTTCCAACCTTGAAGAAGCAAAATTGAAACA

GAATTTTAAAATATTTCCCAAACAATTGCATCATAGTATATTAAAAAAAAAACCCTACCAATTCATTTTGTATAGACCTTTAGAATTGTAAAATAATAAC

CTTGAAAAATGTTTACCAAGACATGGATGGAAATTCTTTTCTTATGACACAAGTAAGAGCGAGGAAAAATTAAAGTGAATTAGAAAATCTTTTATTGCTT

GTGTTTATAAGATCAACGTGGGATCCAAGTACTTAAAATGCTGTTGGAGTGCACCACTGCCAACACTTGCAAAAGTAACGGTACTGCTGGCTTTTCACAA

GGCAAGATTTAGAATCCTACTGTAATGACCATATTTTAAAAAACATGTTATATTTACTAAGTTAACAGCTAATTTTCACTCATTTCCTCCATTTTATTCC

ATGGATGTAAGGTGATAGTTTAACAATGAGAACACATGGTTTGCATTTCGCTATGTATATGTAGTATAGAGGAGAACTAAACCCAGCAGGTAACCGAGGG

TTACTACATGAACACTGGATTGTATTGCCTTTGTCAGTAAGTTCCTCTGTTTAATAAATACTGAAGAAC
Translation
 - UNI34115 - MGPVSVLPSPQSLSTWEGDLAKMTHLQAGLSPDTIEKARLELNENPDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFH

QADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSR RNSFTDILRAILLSLEVLIEDPELQINGFILII

DWSNFSFKQASKLTPSILKLAIEGLQ DSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKR IFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGT

WARTLLGPDYSDENDYTHTSYNAMHVKHTCSNLERECSPKPMKR RSQSVVEAGTLKHEEKGENENTQPLLALD

For any suggestions or comments, please send an email to unitrap@crg.es