Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041219 (Arhgap11a)
Chromosomal location
Chr 2: 113670173 - 113688818 (-)
Description
Rho GTPase activating protein 11A Gene [Source:MGI (curated);Acc:Arhgap11a-001]
RefSeq_dna
NM_181416 
RefSeq_peptide
NP_852081.2 
UniGene
Mm.463543 Mm.474716 Mm.45753 
MGI
MGI:2444300 
Uniprot/SWISSPROT
Q80Y19 
Uniprot/SPTREMBL
A2AL17 Q8CCJ8 A2AL18 A2AL19 
Human Ortholog
ENSG00000187951 (ARHGAP11B)
Omim not available
UniTrap UNI32449
Vector Insertion
Chr 2: 113685411 - 113688455
Public Clones IST10901H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040215
Sequence
GTGGGGCGCTGGCGGAGCCGAGTCACTAAGCTTTAGCGGGCCGGGGCCACAGGCAAGGCTGATGGGCTAGGGGAAAGGCTGCGTGTGAGACGGGGTGACG

GCGGGGACCAGCCCGGGCAGGGACCGGGACTGGGGATCCCTGAGCAGCCGGCTGGCCCGGCTGGAGGGAGTAGCTTAAGGTTGCATTTCCATCTCAAGAA

ATCAGAGCGGGGAAGGCCACCCTGCGGGGAAGAGGATAAGTGGAAGTGTCCGGAAGCGAGAAACTAGCTGCAGGCGTTAGTCTGGGGAAACGGAAGAGTC

AGAAAAAAGGGAAGTTTGTGGAAGTAACTGACAGGGCTGAGCGACCCGGAAAGAAGGCTGGTGGAAGTGAAACAAGAGTGAAGAGAGGCGCGAGAGAAGA

AGGTCTGTGTAAGTGGATCGAGGGAAAGTGGAGGAAGAGTGCCAGAGGTGGCTGGAAGGCAGCGGAGCAGAGCGAGCCTGAGGGCGTTTGGCAAGTGGAA

GAGTTGGTTGGTGGCAAAGAAAGTCAGGACCCGGAGTCGGCCTCGGAGAGTAGGCGACGTGTTCGGGATGTGGGATCAGAGACTGGTCAGATTGGCCCTG

CTGCAGCAGCTTCGAGCTGTCTATGGCATTAAGGTCAAGGGTGGCCGCGGTCAGTGCGATCGCAGGAGACATGAAACTGCAGCTACGGAAATAAAG - U

NI32449 - GGTAAGGTATTTGGAGTACCCTTTAATTCCTTGCCTCATTCAGTCGTTCCAGAATTTGGACACATTCCAAG - UNI32449 - CTTTC

TTGTTGATGCGTGCGCATCTTTAAAAGAGCATATTCATACAGAAGGGCTTTTTAGGAAGTCGGGGTCTGTTGTTCGTCTAAAGGCACTAAAG AGTAAAC

TGGATCAAGGTGAAGCCTGCCTGTCTTCTGCACTTCCGTGTGATGTTGCAGGCCTGCTTAAGCAGTTCTTCCGGGAATTGCCAGAGCCTGTCCTCCCAGC

TGATCTGCATGAAGCACTTTTCAAAGCTCAGCAGTTAGGAGCAGAGGAGAGGAATAAAGCTACATTGTTGCTGTCGTGTCTTATGGCAAACCCTACAGTT

GATATATTAAGATACTTCTTTAACTTTCTTAAGAGTGTTTCTCTTAG GGCAAGTGAGAATAAAATGGACAGCAGCAATCTTGCAGTAATATTTGCACCA

AATCTTCTTCAGACAAGTGAAGGCCATGAGAAGATGTCTGCCAACACAGAGAAGAAGCTACGTCTGCAGGCAGCAGTAGTGCAGACTTTTATTGACTGTG

CATCAGACATTG GACGAGTGCCAGATTTTATCCTGGAAAAGATACCAGCCATGTTAGGTATTGATGGACTCTGTACTACTCCATCCCTGGAAGGCTTTG

AAGGAGACTTTGAAACTCCTGGTGAATGTAAGAGAAAAAGAAGACAAAGTGTTGGAG ATTTTGTGAATGGAGCCCTAAATAAACTTAAATCTAGCAGAA

CACCCTCTATTACACCTCAACAAGATAGGACAG CTCAGGCCTCTGCATCACCATTGATTCTCACCCCGAGTGTTAAGCGTAAACTGCCAGGAGAGTCTT

CTCATGCTTTCTCGAGTAAGAAAAGGAAATCCATCAAGCACAACTTGAACTTTGAGCTGTTGCCAAGTCATTTCTTCAGCAGCAATTCTACACCAGTATC

AG TTCACTTAGATACAAGTCCTGACGGATCATCTCAGACTTCTCTCTCACCAATCGCCATGAGTGGAAACCACTTGGTCAGTACAGAATTAAGGCGAAG

TAAAAGGATTGCCAGCAAAAAAGTTTACAG GGTAGAGTCAGGAAAAGCGGGCTGCTTCTCTCCCAAAGTCAGTCGTAAAGAAAAGACCCGAAGATCTCT

CCGTCTGAAATTTAGTCTGGGGAAGAACAGAGATTCA GATGGATGTTCTGTCATCAATAGATATGAAAATGTTGGTCGACGACTAGCGAATCAGCAAAA

TCTAAAAAGTAGGATTGATTCTGTAAAGACAGGCCTGCTTTTTAGCCCAGATATTGATGAAAGATTGCTAAAGAAAG GCTCAGAAAAGATCAGCAAATC

TGAGGAACACTTGTTAACTCCAGATCAACTAGATGGAACAGGTTACCGGATGTCTTGGACAGAACCCAGTAATTCAAGTTTTCAAGACATGAGTGCAAAT

GGAACTTCTCCAATAATGCAAAATCTTGAGGTGAAGAGCTTTTCTTTGGAGCCCGACATTACTGTTGAAAAATCACCAGTTGTGTCCTGTGAGCTCAGGC

CTTCCACCTTCCATAGCCAGCCTGACAGCAGTGTGCTGTCTCTTAGTGGGGATGAAGGGAACCTGGCCTCCGAGACCTTGCAGAAGATTCAGAAAGCATT

TTCCGAATCTGGGAGTGATCTTCATATGGTGATAAATCATGAGCAGTCATCAGTAACAAATACGGGGGAAGAAGTGGAATTCAGAGATGTGACTGTGACT

GAGTCAAAGGGACATGATGGGAGCTGTGCTGGGGAGGAGGAGAACTGTCCTTCAGAACGGAATTTCTCACCGGATCAAAGCCCAGAGTTTGCCAGAGAAG

CTGATGAGGAATGTTACTCAACTCAGATGAAGGTGGAATGTGAAGGCCTGCACTCAGAAACACCCAAAGCTGACCCCCTCATCCTGCAAGCATTCCCCGG

TGAGGAGCCAGCTGAGGAACCACAGTCCCCAAGGAACCAGCTAAGCACTCCATCACGGGGGAATGAGAATGGGGGGGAGAGCGCTGGGGCAAGTGGAGCT

CCCGGAGAAGATGAGAGCACGTGCAGTGTGGCGGTCCTTTCGAAACCTCGGCCCCAGAGACTTTCGAGGCAACAGTCACTGGTGGAAAAATGTGATAGTG

TAGCTCCTGGGGCTCTACAAGTGACAGAGCACGGGAAGGTTTCTGATCACATACAGTGGTTTAATAAACTTTCTCTAAATGAACCGAACAGAGGAAAAGT

GAAGTCACCTCTTAAATTTCAGCGTACTCCTGTCCGTCAGTCCGTCAGAAGAATTAATTCTTTGTTGGAGTATGGCAGGCAGCCTGTGAGGCAGAAGTTG

GCAATCTTTGGTGACGCAGCTTCTCCTCTCGTTAAATCAGTGAGCTGTGACAGTGCCCTTCCCTCTTGTGTACAAAACACATCAAAAGGTCCCACTGCTC

CACTTATCACGTCAGGCCTCGAAGCACAGAAGTCTACGTCTTGTAATAAATCAAGTGTTGAGTTAACTTCTAAATCTTTCACAAAAATGAAGAGACATCC

GGATCCTTTGAGTGCTTCTCTTGGGACTCCCAGACTTTGTAAGCAGGAGAACAAATCTAATGGCCACATTAAGTTTCCTTTGGATGATCTCACGAATCAT

GAGAGATTAAAATTTGTTGTAAATAACAATGTGGCCTTTTCTCCAGGGATGAAAAACAGAGTTGTTAGGAAACCATCAGAAAAAGAAAGGGTCTGGTACA

AAGGGTCTCCTAAAAATCCTATTGGGAAGACTCAACTGCTACCAACGAGTAAGCCTGTCGACTTGTAACCGTCAAATGTGGCGTGCTCGTCATCAGTGTA

AATAAAATTGCTGGGTCAGGTTGCAGAATGCTCAAGTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACA

 GCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATCGGGGTGCTTGTTAAGTAGGGTCTGTCTGAAGTGGTCCCACTGTAGAGCAGTTTGG

ACTTTCATACTTGCACATGGGGCTACTTTGTTTTTCTTTATTACTGAAGCATTTACACATAACTTTATTGTGATTTCCTGAAGCAGGGGTTATAATAACT

TTAGAAGATACTGTTGGCTAGGTTTATTTATATAAAAGGGACATGAGTTTTATTCTGCATGCTTGATCAGAAGAATACAGGAAGTTGTGCTTGTGCCTCT

TGTTATTCCTTCACATCAGGAACATTGTTCACAGAAACTTCTAGTACATAAAGGGAATGATGAAGCCCTGCAAACCTTATGTCTTGAATTATTCATGTTT

GTTGCCTTGACCCAAAACCAAGAAGTTAATTGGCCTCAGTGGTATGTGAACACTTTTGTTGGAGACAGAGGGATTTATTTGGTCAGCATCGCCTGTGGTT

TCACTTGAATTTTGAATTAAAGACAGTGAATAAAGCATAATGACAACAAAGGTACTGCATACTTTATAATGTTGAGGTAAATGATTAATCGTAAGCCATA

CTTCATTTTTAAAGGTGATTTGGATCATATTTTGTCCAGTATGACAATGAAATTTTTAGGCAGGTATAGTTAAACTGGAAAATTTTAATCAAGTTGTTTT

TTTCCTATGAAGATGGTTGATTTTAGAATTGAATTGTTAATGTACCTCTGTACATTTTACTTAGATAAATATCAGATAGTGTTATCATGTGTTTAAATGT

TATTTATTTAGCATAGACATTAAAAATAGCTCCTGGGAAACGTCTTGTCTGCGTGTTGTATTTTAGATGTAAAACACTGCACACACTATCAGTGTGCGTT

TGTGTGTGAAGAACTAACGTCAGGTTCTCAGGGTTACTTTGCAGGTTCTACGTGAAGCCTTGCGGTGATTAGATTTATTTTACATGTGTGTTGTCTTCAT

GTAAGTATGTATAACACACGTGTGCCTGTCCTCTAAGATGAGAACAGCAGTTGATATCCTGGATGGTTGTGAGCCACTGTGTTGGTTCTGGTAACCAAAC

CTGGGCCTTCTCTGTAGGATTGGAAACCAAACCTGAGTCCTTTACAAGAGCAACAAGTGCTTTTTAGCTGTAGTACAACCCTTCCACCCCCAAATTTCTG

TTTTATTTCAAAAGTTCATTATATTTCCAATGTTCATTATCTAGTAAAACTCTCTAGTCTTAAACTTCATATTCATCTGATCAAAACAGACTAGCCATGC

ATTTTCAGTATGCCTGGAACAGGTTGTATGGATCTTATACCTAAAGTGGATAAGAGAAATATTTCAGATTTTGGAATATTACATAGGTTTTACTGATTGA

AGTGCTTCCAAATGTGAAACATTTTGAGCTAAGTTTTCCTGTGTATTAAGAAAGCCTCCTATGATTTCAGTGGGTGTTTAATGCCTGAGCAGAGCATGGT

GCAGATGCACTCAGAAGATAGAGGTGTGTGGTGGTGGTGGGGAATCTACAATTTAAGATTGAGGAATGAGTTGTTTAACTCTTTAAGATTCCACATTTCT

TATTTGGGAGGTGAGAAAGTTTTAAAATGTGGTTTCATTTTTGTATTTCTTATCTTATTCAAAAATGAAGATTGTTGCTAATTTCATGGGCTAAAGGTCA

GACAGTATATACATTTTTGCTTTCTGAAGTTAAAAGTGTACAGTAACTTCAAGAGTTATTCTCATTTTTTTAAGTGTAAGAAACTAGTATTTGGGTGTTC

TCATAAATAAGCAGTAGATTTTAATACACAAAGCACTAAAGTTAGTGGGTTTCTGGGTTACATTCTACGGTCACTAAGAACTTACTGTAGGGTTTTGAGA

AACAAGTATAGGATATATATGATTCATATTTTATTTTAAAAATACCAGGTTTTAGTCAAGTGTACTGGCACATGCCTGTAATCTTACCTATTCTGGAGGC

TGAGGTATGTAGGCTCTTTTGAGATCAGCCATGGTAAGACCCATGCACTCCTCAAGCTTGCATGTGAACTGTTGCCCAGGGGCTCAAGCTGAATGCTTTG

TTCCTAGCTAGTGGCACTGTAGCAGTTGTAGAACCATTAGGAGTAAGTGTGTCACTGGGGGACCTTGTATGCTCTGCTCTTTATCCTGACCCTCCATGAG

CTCCCACCGTCATGTACTGAAATCTCAAAAGTTGTGAACCAAAATTTTATAAAAATGTCCTTTCCATCTGCATTTTGTCAGCAATAAAAGGTCTTCACAC

CCTGTCTAATAAGTAC
Translation
MWDQRLVRLALLQQLRAVYGIKVKGGRGQCDRRRHETAATEIK - UNI32449 - GKVFGVPFNSLPHSVVPEFGHIPS - UNI32449 - SFLVD

ACASLKEHIHTEGLFRKSGSVVRLKALK SKLDQGEACLSSALPCDVAGLLKQFFRELPEPVLPADLHEALFKAQQLGAEERNKATLLLSCLMANPTVDI

LRYFFNFLKSVSLR RASENKMDSSNLAVIFAPNLLQTSEGHEKMSANTEKKLRLQAAVVQTFIDCASDIG GRVPDFILEKIPAMLGIDGLCTTPSLEG

FEGDFETPGECKRKRRQSVGD DFVNGALNKLKSSRTPSITPQQDRTA AQASASPLILTPSVKRKLPGESSHAFSSKKRKSIKHNLNFELLPSHFFSSN

STPVSV VHLDTSPDGSSQTSLSPIAMSGNHLVSTELRRSKRIASKKVYR RVESGKAGCFSPKVSRKEKTRRSLRLKFSLGKNRDS DGCSVINRYENV

GRRLANQQNLKSRIDSVKTGLLFSPDIDERLLKKG GSEKISKSEEHLLTPDQLDGTGYRMSWTEPSNSSFQDMSANGTSPIMQNLEVKSFSLEPDITVE

KSPVVSCELRPSTFHSQPDSSVLSLSGDEGNLASETLQKIQKAFSESGSDLHMVINHEQSSVTNTGEEVEFRDVTVTESKGHDGSCAGEEENCPSERNFS

PDQSPEFAREADEECYSTQMKVECEGLHSETPKADPLILQAFPGEEPAEEPQSPRNQLSTPSRGNENGGESAGASGAPGEDESTCSVAVLSKPRPQRLSR

QQSLVEKCDSVAPGALQVTEHGKVSDHIQWFNKLSLNEPNRGKVKSPLKFQRTPVRQSVRRINSLLEYGRQPVRQKLAIFGDAASPLVKSVSCDSALPSC

VQNTSKGPTAPLITSGLEAQKSTSCNKSSVELTSKSFTKMKRHPDPLSASLGTPRLCKQENKSNGHIKFPLDDLTNHERLKFVVNNNVAFSPGMKNRVVR

KPSEKERVWYKGSPKNPIGKTQLLPTSKPVDL 
Transcript ENSMUST00000102545
Sequence
GTGGGGCGCTGGCGGAGCCGAGTCACTAAGCTTTAGCGGGCCGGGGCCACAGGCAAGGCTGATGGGCTAGGGGAAAGGCTGCGTGTGAGACGGGGTGACG

GCGGGGACCAGCCCGGGCAGGGACCGGGACTGGGGATCCCTGAGCAGCCGGCTGGCCCGGCTGGAGGGAGTAGCTTAAGGTTGCATTTCCATCTCAAGAA

ATCAGAGCGGGGAAGGCCACCCTGCGGGGAAGAGGATAAGTGGAAGTGTCCGGAAGCGAGAAACTAGCTGCAGGCGTTAGTCTGGGGAAACGGAAGAGTC

AGAAAAAAGGGAAGTTTGTGGAAGTAACTGACAGGGCTGAGCGACCCGGAAAGAAGGCTGGTGGAAGTGAAACAAGAGTGAAGAGAGGCGCGAGAGAAGA

AGGTCTGTGTAAGTGGATCGAGGGAAAGTGGAGGAAGAGTGCCAGAGGTGGCTGGAAGGCAGCGGAGCAGAGCGAGCCTGAGGGCGTTTGGCAAGTGGAA

GAGTTGGTTGGTGGCAAAGAAAGTCAGGACCCGGAGTCGGCCTCGGAGAGTAGGCGACGTGTTCGGGATGTGGGATCAGAGACTGGTCAGATTGGCCCTG

CTGCAGCAGCTTCGAGCTGTCTATGGCATTAAGGTCAAGGGTGGCCGCGGTCAGTGCGATCGCAGGAGACATGAAACTGCAGCTACGGAAATAAAG - U

NI32449 - GGTAAGGTATTTGGAGTACCCTTTAATTCCTTGCCTCATTCAGTCGTTCCAGAATTTGGACACATTCCAAG - UNI32449 - CTTTC

TTGTTGATGCGTGCGCATCTTTAAAAGAGCATATTCATACAGAAGGGCTTTTTAGGAAGTCGGGGTCTGTTGTTCGTCTAAAGGCACTAAAG AGTAAAC

TGGATCAAGGTGAAGCCTGCCTGTCTTCTGCACTTCCGTGTGATGTTGCAGGCCTGCTTAAGCAGTTCTTCCGGGAATTGCCAGAGCCTGTCCTCCCAGC

TGATCTGCATGAAGCACTTTTCAAAGCTCAGCAGTTAGGAGCAGAGGAGAGGAATAAAGCTACATTGTTGCTGTCGTGTCTTATGGCAAACCCTACAGTT

GATATATTAAGATACTTCTTTAACTTTCTTAAGAGTGTTTCTCTTAG GGCAAGTGAGAATAAAATGGACAGCAGCAATCTTGCAGTAATATTTGCACCA

AATCTTCTTCAGACAAGTGAAGGCCATGAGAAGATGTCTGCCAACACAGAGAAGAAGCTACGTCTGCAGGCAGCAGTAGTGCAGACTTTTATTGACTGTG

CATCAGACATTG GACGAGTGCCAGATTTTATCCTGGAAAAGATACCAGCCATGTTAGGTATTGATGGACTCTGTACTACTCCATCCCTGGAAGGCTTTG

AAGGAGACTTTGAAACTCCTGGTGAATGTAAGAGAAAAAGAAGACAAAGTGTTGGAG ATTTTGTGAATGGAGCCCTAAATAAACTTAAATCTAGCAGAA

CACCCTCTATTACACCTCAACAAGATAGGACAG CTCAGGCCTCTGCATCACCATTGATTCTCACCCCGAGTGTTAAGCGTAAACTGCCAGGAGAGTCTT

CTCATGCTTTCTCGAGTAAGAAAAGGAAATCCATCAAGCACAACTTGAACTTTGAGCTGTTGCCAAGTCATTTCTTCAGCAGCAATTCTACACCAGTATC

AG TTCACTTAGATACAAGTCCTGACGGATCATCTCAGACTTCTCTCTCACCAATCGCCATGAGTGGAAACCACTTGGTCAGTACAGAATTAAGGCGAAG

TAAAAGGATTGCCAGCAAAAAAGTTTACAG GGTAGAGTCAGGAAAAGCGGGCTGCTTCTCTCCCAAAGTCAGTCGTAAAGAAAAGACCCGAAGATCTCT

CCGTCTGAAATTTAGTCTGGGGAAGAACAGAGATTCA GATGGATGTTCTGTCATCAATAGATATGAAAATGTTGGTCGACGACTAGCGAATCAGCAAAA

TCTAAAAAGTAGGATTGATTCTGTAAAGACAGGCCTGCTTTTTAGCCCAGATATTGATGAAAGATTGCTAAAGAAAG GCTCAGAAAAGATCAGCAAATC

TGAGGAACACTTGTTAACTCCAGATCAACTAGATGGAACAGGTTACCGGATGTCTTGGACAGAACCCAGTAATTCAAGTTTTCAAGACATGAGTGCAAAT

GGAACTTCTCCAATAATGCAAAATCTTGAGGTGAAGAGCTTTTCTTTGGAGCCCGACATTACTGTTGAAAAATCACCAGTTGTGTCCTGTGAGCTCAGGC

CTTCCACCTTCCATAGCCAGCCTGACAGCAGTGTGCTGTCTCTTAGTGGGGATGAAGGGAACCTGGCCTCCGAGACCTTGCAGAAGATTCAGAAAGCATT

TTCCGAATCTGGGAGTGATCTTCATATGGTGATAAATCATGAGCAGTCATCAGTAACAAATACGGGGGAAGAAGTGGAATTCAGAGATGTGACTGTGACT

GAGTCAAAGGGACATGATGGGAGCTGTGCTGGGGAGGAGGAGAACTGTCCTTCAGAACGGAATTTCTCACCGGATCAAAGCCCAGAGTTTGCCAGAGAAG

CTGATGAGGAATGTTACTCAACTCAGATGAAGGTGGAATGTGAAGGCCTGCACTCAGAAACACCCAAAGCTGACCCCCTCATCCTGCAAGCATTCCCCGG

TGAGGAGCCAGCTGAGGAACCACAGTCCCCAAGGAACCAGCTAAGCACTCCATCACGGGGGAATGAGAATGGGGGGGAGAGCGCTGGGGCAAGTGGAGCT

CCCGGAGAAGATGAGAGCACGTGCAGTGTGGCGGTCCTTTCGAAACCTCGGCCCCAGAGACTTTCGAGGCAACAGTCACTGGTGGAAAAATGTGATAGTG

TAGCTCCTGGGGCTCTACAAGTGACAGAGCACGGGAAGGTTTCTGATCACATACAGTGGTTTAATAAACTTTCTCTAAATGAACCGAACAGAGGAAAAGT

GAAGTCACCTCTTAAATTTCAGCGTACTCCTGTCCGTCAGTCCGTCAGAAGAATTAATTCTTTGTTGGAGTATGGCAGGCAGCCTGTGAGGCAGAAGTTG

GCAATCTTTGGTGACGCAGCTTCTCCTCTCGTTAAATCAGTGAGCTGTGACAGTGCCCTTCCCTCTTGTGTACAAAACACATCAAAAGGTCCCACTGCTC

CACTTATCACGTCAGGCCTCGAAGCACAGAAGTCTACGTCTTGTAATAAATCAAGTGTTGAGTTAACTTCTAAATCTTTCACAAAAATGAAGAGACATCC

GGATCCTTTGAGTGCTTCTCTTGGGACTCCCAGACTTTGTAAGCAGGAGAACAAATCTAATGGCCACATTAAGTTTCCTTTGGATGATCTCACGAATCAT

GAGAGATTAAAATTTGTTGTAAATAACAATGTGGCCTTTTCTCCAGGGATGAAAAACAGAGTTGTTAGGAAACCATCAGAAAAAGAAAGGGTCTGGTACA

AAGGGTCTCCTAAAAATCCTATTGGGAAGACTCAACTGCTACCAACGAGTAAGCCTGTCGACTTGTAACCGTCAAATGTGGCGTGCTCGTCATCAGTGTA

AATAAAATTGCTGGGTCAGGTTGCAGAATGCTCAAGTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACA

GCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGGCGGGCGG

GCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACAGCGGGCGGGCAGTTGC

AGGATGCTTGTGTGCTGGTGTGTAGATATGGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCT

TGTGTGCTGGTGTGTAGATATGGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACAGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCT

GGTGTGTAGATATGGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTA

GATACAGCGGGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATCGGGGTGCTTGTTAAGTAGGGTCTGTCTGAAGTGGTCCCACTGTAGA

GCAGTTTGGACTTTCATACTTGCACATGGGGCTACTTTGTTTTTCTTTATTACTGAAGCATTTACACATAACTTTATTGTGATTTCCTGAAGCAGGGGTT

ATAATAACTTTAGAAGATACTGTTGGCTAGGTTTATTTATATAAAAGGGACATGAGTTTTATTCTGCATGCTTGATCAGAAGAATACAGGAAGTTGTGCT

TGTGCCTCTTGTTATTCCTTCACATCAGGAACATTGTTCACAGAAACTTCTAGTACATAAAGGGAATGATGAAGCCCTGCAAACCTTATGTCTTGAATTA

TTCATGTTTGTTGCCTTGACCCAAAACCAAGAAGTTAATTGGCCTCAGTGGTATGTGAACACTTTTGTTGGAGACAGAGGGATTTATTTGGTCAGCATCG

CCTGTGGTTTCACTTGAATTTTGAATTAAAGACAGTGAATAAAGCATAATGACAACAAAGGTACTGCATACTTTATAATGTTGAGGTAAATGATTAATCG

TAAGCCATACTTCATTTTTAAAGGTGATTTGGATCATATTTTGTCCAGTATGACAATGAAATTTTTAGGCAGGTATAGTTAAACTGGAAAATTTTAATCA

AGTTGTTTTTTTCCTATGAAGATGGTTGATTTTAGAATTGAATTGTTAATGTACCTCTGTACATTTTACTTAGATAAATATCAGATAGTGTTATC
Translation
MWDQRLVRLALLQQLRAVYGIKVKGGRGQCDRRRHETAATEIK - UNI32449 - GKVFGVPFNSLPHSVVPEFGHIPS - UNI32449 - SFLVD

ACASLKEHIHTEGLFRKSGSVVRLKALK SKLDQGEACLSSALPCDVAGLLKQFFRELPEPVLPADLHEALFKAQQLGAEERNKATLLLSCLMANPTVDI

LRYFFNFLKSVSLR RASENKMDSSNLAVIFAPNLLQTSEGHEKMSANTEKKLRLQAAVVQTFIDCASDIG GRVPDFILEKIPAMLGIDGLCTTPSLEG

FEGDFETPGECKRKRRQSVGD DFVNGALNKLKSSRTPSITPQQDRTA AQASASPLILTPSVKRKLPGESSHAFSSKKRKSIKHNLNFELLPSHFFSSN

STPVSV VHLDTSPDGSSQTSLSPIAMSGNHLVSTELRRSKRIASKKVYR RVESGKAGCFSPKVSRKEKTRRSLRLKFSLGKNRDS DGCSVINRYENV

GRRLANQQNLKSRIDSVKTGLLFSPDIDERLLKKG GSEKISKSEEHLLTPDQLDGTGYRMSWTEPSNSSFQDMSANGTSPIMQNLEVKSFSLEPDITVE

KSPVVSCELRPSTFHSQPDSSVLSLSGDEGNLASETLQKIQKAFSESGSDLHMVINHEQSSVTNTGEEVEFRDVTVTESKGHDGSCAGEEENCPSERNFS

PDQSPEFAREADEECYSTQMKVECEGLHSETPKADPLILQAFPGEEPAEEPQSPRNQLSTPSRGNENGGESAGASGAPGEDESTCSVAVLSKPRPQRLSR

QQSLVEKCDSVAPGALQVTEHGKVSDHIQWFNKLSLNEPNRGKVKSPLKFQRTPVRQSVRRINSLLEYGRQPVRQKLAIFGDAASPLVKSVSCDSALPSC

VQNTSKGPTAPLITSGLEAQKSTSCNKSSVELTSKSFTKMKRHPDPLSASLGTPRLCKQENKSNGHIKFPLDDLTNHERLKFVVNNNVAFSPGMKNRVVR

KPSEKERVWYKGSPKNPIGKTQLLPTSKPVDL
Transcript ENSMUST00000110949
Sequence
GTGGGGCGCTGGCGGAGCCGAGTCACTAAGCTTTAGCGGGCCGGGGCCACAGGCAAGGCTGATGGGCTAGGGGAAAGGCTGCGTGTGAGACGGGGTGACG

GCGGGGACCAGCCCGGGCAGGGACCGGGACTGGGGATCCCTGAGCAGCCGGCTGGCCCGGCTGGAGGGAGTAGCTTAAGGTTGCATTTCCATCTCAAGAA

ATCAGAGCGGGGAAGGCCACCCTGCGGGGAAGAGGATAAGTGGAAGTGTCCGGAAGCGAGAAACTAGCTGCAGGCGTTAGTCTGGGGAAACGGAAGAGTC

AGAAAAAAGGGAAGTTTGTGGAAGTAACTGACAGGGCTGAGCGACCCGGAAAGAAGGCTGGTGGAAGTGAAACAAGAGTGAAGAGAGGCGCGAGAGAAGA

AGGTCTGTGTAAGTGGATCGAGGGAAAGTGGAGGAAGAGTGCCAGAGGTGGCTGGAAGGCAGCGGAGCAGAGCGAGCCTGAGGGCGTTTGGCAAGTGGAA

GAGTTGGTTGGTGGCAAAGAAAGTCAGGACCCGGAGTCGGCCTCGGAGAGTAGGCGACGTGTTCGGGATGTGGGATCAGAGACTGGTCAGATTGGCCCTG

CTGCAGCAGCTTCGAGCTGTCTATGGCATTAAGGTCAAGGGTGGCCGCGGTCAGTGCGATCGCAGGAGACATGAAACTGCAGCTACGGAAATAAAG - U

NI32449 - GGTAAGGTATTTGGAGTACCCTTTAATTCCTTGCCTCATTCAGTCGTTCCAGAATTTGGACACATTCCAAG - UNI32449 - CTTTC

TTGTTGATGCGTGCGCATCTTTAAAAGAGCATATTCATACAGAAGGGCTTTTTAGGAAGTCGGGGTCTGTTGTTCGTCTAAAGGCACTAAAG AGTAAAC

TGGATCAAGGTGAAGCCTGCCTGTCTTCTGCACTTCCGTGTGATGTTGCAGGCCTGCTTAAGCAGTTCTTCCGGGAATTGCCAGAGCCTGTCCTCCCAGC

TGATCTGCATGAAGCACTTTTCAAAGCTCAGCAGTTAGGAGCAGAGGAGAGGAATAAAGCTACATTGTTGCTGTCGTGTCTTATGGCAAACCCTACAGTT

GATATATTAAGATACTTCTTTAACTTTCTTAAGAGTGTTTCTCTTAG GGCAAGTGAGAATAAAATGGACAGCAGCAATCTTGCAGTAATATTTGCACCA

AATCTTCTTCAGACAAGTGAAGGCCATGAGAAGATGTCTGCCAACACAGAGAAGAAGCTACGTCTGCAGGCAGCAGTAGTGCAGACTTTTATTGACTGTG

CATCAGACATTG GACGAGTGCCAGATTTTATCCTGGAAAAGATACCAGCCATGTTAGGTATTGATGGACTCTGTACTACTCCATCCCTGGAAGGCTTTG

AAGGAGACTTTGAAACTCCTGGTGAATGTAAGAGAAAAAGAAGACAAAGTGTTGGAG ATTTTGTGAATGGAGCCCTAAATAAACTTAAATCTAGCAGAA

CACCCTCTATTACACCTCAACAAGATAGGACAG CTCAGGCCTCTGCATCACCATTGATTCTCACCCCGAGTGTTAAGCGTAAACTGCCAGGAGAGTCTT

CTCATGCTTTCTCGAGTAAGAAAAGGAAATCCATCAAGCACAACTTGAACTTTGAGCTGTTGCCAAGTCATTTCTTCAGCAGCAATTCTACACCAGTATC

AG TTCACTTAGATACAAGTCCTGACGGATCATCTCAGACTTCTCTCTCACCAATCGCCATGAGTGGAAACCACTTGGTCAGTACAGAATTAAGGCGAAG

TAAAAGGATTGCCAGCAAAAAAGTTTACAG GGTAGAGTCAGGAAAAGCGGGCTGCTTCTCTCCCAAAGTCAGTCGTAAAGAAAAGACCCGAAGATCTCT

CCGTCTGAAATTTAGTCTGGGGAAGAACAGAGATTCA GCTCAGAAAAGATCAGCAAATCTGAGGAACACTTGTTAACTCCAGATCAACTAGATGGAACA

GGTTACCGGATGTCTTGGACAGAACCCAGTAATTCAAGTTTTCAAGACATGAGTGCAAATGGAACTTCTCCAATAATGCAAAATCTTGAGGTGAAGAGCT

TTTCTTTGGAGCCCGACATTACTGTTGAAAAATCACCAGTTGTGTCCTGTGAGCTCAGGCCTTCCACCTTCCATAGCCAGCCTGACAGCAGTGTGCTGTC

TCTTAGTGGGGATGAAGGGAACCTGGCCTCCGAGACCTTGCAGAAGATTCAGAAAGCATTTTCCGAATCTGGGAGTGATCTTCATATGGTGATAAATCAT

GAGCAGTCATCAGTAACAAATACGGGGGAAGAAGTGGAATTCAGAGATGTGACTGTGACTGAGTCAAAGGGACATGATGGGAGCTGTGCTGGGGAGGAGG

AGAACTGTCCTTCAGAACGGAATTTCTCACCGGATCAAAGCCCAGAGTTTGCCAGAGAAGCTGATGAGGAATGTTACTCAACTCAGATGAAGGTGGAATG

TGAAGGCCTGCACTCAGAAACACCCAAAGCTGACCCCCTCATCCTGCAAGCATTCCCCGGTGAGGAGCCAGCTGAGGAACCACAGTCCCCAAGGAACCAG

CTAAGCACTCCATCACGGGGGAATGAGAATGGGGGGGAGAGCGCTGGGGCAAGTGGAGCTCCCGGAGAAGATGAGAGCACGTGCAGTGTGGCGGTCCTTT

CGAAACCTCGGCCCCAGAGACTTTCGAGGCAACAGTCACTGGTGGAAAAATGTGATAGTGTAGCTCCTGGGGCTCTACAAGTGACAGAGCACGGGAAGGT

TTCTGATCACATACAGTGGTTTAATAAACTTTCTCTAAATGAACCGAACAGAGGAAAAGTGAAGTCACCTCTTAAATTTCAGCGTACTCCTGTCCGTCAG

TCCGTCAGAAGAATTAATTCTTTGTTGGAGTATGGCAGGCAGCCTGTGAGGCAGAAGTTGGCAATCTTTGGTGACGCAGCTTCTCCTCTCGTTAAATCAG

TGAGCTGTGACAGTGCCCTTCCCTCTTGTGTACAAAACACATCAAAAGGTCCCACTGCTCCACTTATCACGTCAGGCCTCGAAGCACAGAAGTCTACGTC

TTGTAATAAATCAAGTGTTGAGTTAACTTCTAAATCTTTCACAAAAATGAAGAGACATCCGGATCCTTTGAGTGCTTCTCTTGGGACTCCCAGACTTTGT

AAGCAGGAGAACAAATCTAATGGCCACATTAAGTTTCCTTTGGATGATCTCACGAATCATGAGAGATTAAAATTTGTTGTAAATAACAATGTGGCCTTTT

CTCCAGGGATGAAAAACAGAGTTGTTAGGAAACCATCAGAAAAAGAAAGGGTCTGGTACAAAGGGTCTCCTAAAAATCCTATTGGGAAGACTCAACTGCT

ACCAACGAGTAAGCCTGTCGACTTGTAACCGTCAAATGTGGCGTGCTCGTCATCAGTGTAAATAAAATTGCTGGGTCAGGTTGCAGAATGCTCAAGTGCT

GGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACA GCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGT

AGATCGGGGTGCTTGTTAAGTAGGGTCTGTCTGAAGTGGTCCCACTGTAGAGCAGTTTGGACTTTCATACTTGCACATGGGGCTACTTTGTTTTTCTTTA

TTACTGAAGCATTTACACATAACTTTATTGTGATTTCCTGAAGCAGGGGTTATAATAACTTTAGAAGATACTGTTGGCTAGGTTTATTTATATAAAAGGG

ACATGAGTTTTATTCTGCATGCTTGATCAGAAGAATACAGGAAGTTGTGCTTGTGCCTCTTGTTATTCCTTCACATCAGGAACATTGTTCACAGAAACTT

CTAGTACATAAAGGGAATGATGAAGCCCTGCAAACCTTATGTCTTGAATTATTCATGTTTGTTGCCTTGACCCAAAACCAAGAAGTTAATTGGCCTCAGT

GGTATGTGAACACTTTTGTTGGAGACAGAGGGATTTATTTGGTCAGCATCGCCTGTGGTTTCACTTGAATTTTGAATTAAAGACAGTGAATAAAGCATAA

TGACAACAAAGGTACTGCATACTTTATAATGTTGAGGTAAATGATTAATCGTAAGCCATACTTCATTTTTAAAGGTGATTTGGATCATATTTTGTCCAGT

ATGACAATGAAATTTTTAGGCAGGTATAGTTAAACTGGAAAATTTTAATCAAGTTGTTTTTTTCCTATGAAGATGGTTGATTTTAGAATTGAATTGTTAA

TGTACCTCTGTACATTTTACTTAGATAAATATCAGATAGTGTTATCATGTGTTTAAATGTTATTTATTTAGCATAGACATTAAAAATAGCTCCTGGGAAA

CGTCTTGTCTGCGTGTTGTATTTTAGATGTAAAACACTGCACACACTATCAGTGTGCGTTTGTGTGTGAAGAACTAACGTCAGGTTCTCAGGGTTACTTT

GCAGGTTCTACGTGAAGCCTTGCGGTGATTAGATTTATTTTACATGTGTGTTGTCTTCATGTAAGTATGTATAACACACGTGTGCCTGTCCTCTAAGATG

AGAACAGCAGTTGATATCCTGGATGGTTGTGAGCCACTGTGTTGGTTCTGGTAACCAAACCTGGGCCTTCTCTGTAGGATTGGAAACCAAACCTGAGTCC

TTTACAAGAGCAACAAGTGCTTTTTAGCTGTAGTACAACCCTTCCACCCCCAAATTTCTGTTTTATTTCAAAAGTTCATTATATTTCCAATGTTCATTAT

CTAGTAAAACTCTCTAGTCTTAAACTTCATATTCATCTGATCAAAACAGACTAGCCATGCATTTTCAGTATGCCTGGAACAGGTTGTATGGATCTTATAC

CTAAAGTGGATAAGAGAAATATTTCAGATTTTGGAATATTACATAGGTTTTACTGATTGAAGTGCTTCCAAATGTGAAACATTTTGAGCTAAGTTTTCCT

GTGTATTAAGAAAGCCTCCTATGATTTCAGTGGGTGTTTAATGCCTGAGCAGAGCATGGTGCAGATGCACTCAGAAGATAGAGGTGTGTGGTGGTGGTGG

GGAATCTACAATTTAAGATTGAGGAATGAGTTGTTTAACTCTTTAAGATTCCACATTTCTTATTTGGGAGGTGAGAAAGTTTTAAAATGTGGTTTCATTT

TTGTATTTCTTATCTTATTCAAAAATGAAGATTGTTGCTAATTTCATGGGCTAAAGGTCAGACAGTATATACATTTTTGCTTTCTGAAGTTAAAAGTGTA

CAGTAACTTCAAGAGTTATTCTCATTTTTTTAAGTGTAAGAAACTAGTATTTGGGTGTTCTCATAAATAAGCAGTAGATTTTAATACACAAAGCACTAAA

GTTAGTGGGTTTCTGGGTTACATTCTACGGTCACTAAGAACTTACTGTAGGGTTTTGAGAAACAAGTATAGGATATATATGATTCATATTTTATTTTAAA

AATACCAGGTTTTAGTCAAGTGTACTGGCACATGCCTGTAATCTTACCTATTCTGGAGGCTGAGGTATGTAGGCTCTTTTGAGATCAGCCATGGTAAGAC

CCATGCACTCCTCAAGCTTGCATGTGAACTGTTGCCCAGGGGCTCAAGCTGAATGCTTTGTTCCTAGCTAGTGGCACTGTAGCAGTTGTAGAACCATTAG

GAGTAAGTGTGTCACTGGGGGACCTTGTATGCTCTGCTCTTTATCCTGACCCTCCATGAGCTCCCACCGTCATGTACTGAAATCTCAAAAGTTGTGAACC

AAAATTTTATAAAAATGTCCTTTCCATCTGCATTTTGTCAGCAATAAAAGGTCTTCACACCCTGTCTAATAAGTAC
Translation
MWDQRLVRLALLQQLRAVYGIKVKGGRGQCDRRRHETAATEIK - UNI32449 - GKVFGVPFNSLPHSVVPEFGHIPS - UNI32449 - SFLVD

ACASLKEHIHTEGLFRKSGSVVRLKALK SKLDQGEACLSSALPCDVAGLLKQFFRELPEPVLPADLHEALFKAQQLGAEERNKATLLLSCLMANPTVDI

LRYFFNFLKSVSLR RASENKMDSSNLAVIFAPNLLQTSEGHEKMSANTEKKLRLQAAVVQTFIDCASDIG GRVPDFILEKIPAMLGIDGLCTTPSLEG

FEGDFETPGECKRKRRQSVGD DFVNGALNKLKSSRTPSITPQQDRTA AQASASPLILTPSVKRKLPGESSHAFSSKKRKSIKHNLNFELLPSHFFSSN

STPVSV VHLDTSPDGSSQTSLSPIAMSGNHLVSTELRRSKRIASKKVYR RVESGKAGCFSPKVSRKEKTRRSLRLKFSLGKNRDS AQKRSANLRNTC

 
Transcript ENSMUST00000110948
Sequence
AGAAGGTGGGGCGCTGGCGGAGCCGAGTCACTAAGCTTTAGCGGGCCGGGGCCACAGGCAAGGCTGATGGGCTAGGGGAAAGGCTGCGTGTGAGACGGGG

TGACGGCGGGGACCAGCCCGGGCAGGGACCGGGACTGGGGATCCCTGAGCAGCCGGCTGGCCCGGCTGGAGGGAGTAGCTTAAGGTTGCATTTCCATCTC

AAGAAATCAGAGCGGGGAAGGCCACCCTGCGGGGAAGAGGATAAGTGGAAGTGTCCGGAAGCGAGAAACTAGCTGCAGGCGTTAGTCTGGGGAAACGGAA

GAGTCAGAAAAAAGGGAAGTTTGTGGAAGTAACTGACAGGGCTGAGCGACCCGGAAAGAAGGCTGGTGGAAGTGAAACAAGAGTGAAGAGAGGCGCGAGA

GAAGAAGGTCTGTGTAAGTGGATCGAGGGAAAGTGGAGGAAGAGTGCCAGAGGTGGCTGGAAGGCAGCGGAGCAGAGCGAGCCTGAGGGCGTTTGGCAAG

TGGAAGAGTTGGTTGGTGGCAAAGAAAGTCAGGACCCGGAGTCGGCCTCGGAGAGTAGGCGACGTGTTCGGGATGTGGGATCAGAGACTGGTCAGATTGG

CCCTGCTGCAGCAGCTTCGAGCTGTCTATGGCATTAAGGTCAAGGGTGGCCGCGGTCAGTGCGATCGCAGGAGACATGAAACTGCAGCTACGGAAATAAA

G - UNI32449 - GGTAAGGTATTTGGAGTACCCTTTAATTCCTTGCCTCATTCAGTCGTTCCAGAATTTGGACACATTCCAAG - UNI32449 - 

CTTTCTTGTTGATGCGTGCGCATCTTTAAAAGAGCATATTCATACAGAAGGGCTTTTTAGGAAGTCGGGGTCTGTTGTTCGTCTAAAGGCACTAAAG AG

TAAACTGGATCAAGGTGAAGCCTGCCTGTCTTCTGCACTTCCGTGTGATGTTGCAGGCCTGCTTAAGCAGTTCTTCCGGGAATTGCCAGAGCCTGTCCTC

CCAGCTGATCTGCATGAAGCACTTTTCAAAGCTCAGCAGTTAGGAGCAGAGGAGAGGAATAAAGCTACATTGTTGCTGTCGTGTCTTATGGCAAACCCTA

CAGTTGATATATTAAGATACTTCTTTAACTTTCTTAAGAGTGTTTCTCTTAG GGCAAGTGAGAATAAAATGGACAGCAGCAATCTTGCAGTAATATTTG

CACCAAATCTTCTTCAGACAAGTGAAGGCCATGAGAAGATGTCTGCCAACACAGAGAAGAAGCTACGTCTGCAGGCAGCAGTAGTGCAGACTTTTATTGA

CTGTGCATCAGACATTG GACGAGTGCCAGATTTTATCCTGGAAAAGATACCAGCCATGTTAGGTATTGATGGACTCTGTACTACTCCATCCCTGGAAGG

CTTTGAAGGAGACTTTGAAACTCCTGGTGAATGTAAGAGAAAAAGAAGACAAAGTGTTGGAG ATTTTGTGAATGGAGCCCTAAATAAACTTAAATCTAG

CAGAACACCCTCTATTACACCTCAACAAGATAGGACAG CTCAGGCCTCTGCATCACCATTGATTCTCACCCCGAGTGTTAAGCGTAAACTGCCAGGAGA

GTCTTCTCATGCTTTCTCGAGTAAGAAAAGGAAATCCATCAAGCACAACTTGAACTTTGAGCTGTTGCCAAGTCATTTCTTCAGCAGCAATTCTACACCA

GTATCAG TTCACTTAGATACAAGTCCTGACGGATCATCTCAGACTTCTCTCTCACCAATCGCCATGAGTGGAAACCACTTGGTCAGTACAGAATTAAGG

CGAAGTAAAAGGATTGCCAGCAAAAAAGTTTACAG GGTAGAGTCAGGAAAAGCGGGCTGCTTCTCTCCCAAAGTCAGTCGTAAAGAAAAGACCCGAAGA

TCTCTCCGTCTGAAATTTAGTCTGGGGAAGAACAGAGATTCA GCTCAGAAAAGATCAGCAAATCTGAGGAACACTTGTTAACTCCAGATCAACTAGATG

GAACAGGTTACCGGATGTCTTGGACAGAACCCAGTAATTCAAGTTTTCAAGACATGAGTGCAAATGGAACTTCTCCAATAATGCAAAATCTTGAGGTGAA

GAGCTTTTCTTTGGAGCCCGACATTACTGTTGAAAAATCACCAGTTGTGTCCTGTGAGCTCAGGCCTTCCACCTTCCATAGCCAGCCTGACAGCAGTGTG

CTGTCTCTTAGTGGGGATGAAGGGAACCTGGCCTCCGAGACCTTGCAGAAGATTCAGAAAGCATTTTCCGAATCTGGGAGTGATCTTCATATGGTGATAA

ATCATGAGCAGTCATCAGTAACAAATACGGGGGAAGAAGTGGAATTCAGAGATGTGACTGTGACTGAGTCAAAGGGACATGATGGGAGCTGTGCTGGGGA

GGAGGAGAACTGTCCTTCAGAACGGAATTTCTCACCGGATCAAAGCCCAGAGTTTGCCAGAGAAGCTGATGAGGAATGTTACTCAACTCAGATGAAGGTG

GAATGTGAAGGCCTGCACTCAGAAACACCCAAAGCTGACCCCCTCATCCTGCAAGCATTCCCCGGTGAGGAGCCAGCTGAGGAACCACAGTCCCCAAGGA

ACCAGCTAAGCACTCCATCACGGGGGAATGAGAATGGGGGGGAGAGCGCTGGGGCAAGTGGAGCTCCCGGAGAAGATGAGAGCACGTGCAGTGTGGCGGT

CCTTTCGAAACCTCGGCCCCAGAGACTTTCGAGGCAACAGTCACTGGTGGAAAAATGTGATAGTGTAGCTCCTGGGGCTCTACAAGTGACAGAGCACGGG

AAGGTTTCTGATCACATACAGTGGTTTAATAAACTTTCTCTAAATGAACCGAACAGAGGAAAAGTGAAGTCACCTCTTAAATTTCAGCGTACTCCTGTCC

GTCAGTCCGTCAGAAGAATTAATTCTTTGTTGGAGTATGGCAGGCAGCCTGTGAGGCAGAAGTTGGCAATCTTTGGTGACGCAGCTTCTCCTCTCGTTAA

ATCAGTGAGCTGTGACAGTGCCCTTCCCTCTTGTGTACAAAACACATCAAAAGGTCCCACTGCTCCACTTATCACGTCAGGCCTCGAAGCACAGAAGTCT

ACGTCTTGTAATAAATCAAGTGTTGAGTTAACTTCTAAATCTTTCACAAAAATGAAGAGACATCCGGATCCTTTGAGTGCTTCTCTTGGGACTCCCAGAC

TTTGTAAGCAGGAGAACAAATCTAATGGCCACATTAAGTTTCCTTTGGATGATCTCACGAATCATGAGAGATTAAAATTTGTTGTAAATAACAATGTGGC

CTTTTCTCCAGGGATGAAAAACAGAGTTGTTAGGAAACCATCAGAAAAAGAAAGGGTCTGGTACAAAGGGTCTCCTAAAAATCCTATTGGGAAGACTCAA

CTGCTACCAACGAGTAAGCCTGTCGACTTGTAACCGTCAAATGTGGCGTGCTCGTCATCAGTGTAAATAAAATTGCTGGGTCAGGTTGCAGAATGCTCAA

GTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACAGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGT

GTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGAT

ATGGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACAGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGGCGGG

CGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGGCGGGCGGGCAGT

TGCAGGATGCTTGTGTGCTGGTGTGTAGATACAGCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATATGGCGGGCGGGCAGTTGCAGGAT

GCTTGTGTGCTGGTGTGTAGATATGTCGGGCGGGCAGTTGCAGGATGCTTGTGTGCTGGTGTGTAGATACAGCGGGCGGGCGGGCAGTTGCAGGATGCTT

GTGTGCTGGTGTGTAGATCGGGGTGCTTGTTAAGTAGGGTCTGTCTGAAGTGGTCCCACTGTAGAGCAGTTTGGACTTTCATACTTGCACATGGGGCTAC

TTTGTTTTTCTTTATTACTGAAGCATTTACACATAACTTTATTGTGATTTCCTGAAGCAGGGGTTATAATAACTTTAGAAGATACTGTTGGCTAGGTTTA

TTTATATAAAAGGGACATGAGTTTTATTCTGCATGCTTGATCAGAAGAATACAGGAAGTTGTGCTTGTGCCTCTTGTTATTCCTTCACATCAGGAACATT

GTTCACAGAAACTTCTAGTACATAAAGGGAATGATGAAGCCCTGCAAACCTTATGTCTTGAATTATTCATGTTTGTTGCCTTGACCCAAAACCAAGAAGT

TAATTGGCCTCAGTGGTATGTGAACACTTTTGTTGGAGACAGAGGGATTTATTTGGTCAGCATCGCCTGTGGTTTCACTTGAATTTTGAATTAAAGACAG

TGAATAAAGCATAATGACAACAAAGGTACTGCATACTTTATAATGTTGAGGTAAATGATTAATCGTAAGCCATACTTCATTTTTAAAGGTGATTTGGATC

ATATTTTGTCCAGTATGACAATGAAATTTTTAGGCAGGTATAGTTAAACTGGAAAATTTTAATCAAGTTGTTTTTTTCCTATGAAGATGGTTGATTTTAG

AATTGAATTGTTAATGTACCTCTGTACATTTTACTTAGATAAATATCAGATAGTGTTATCATGTGTTTAAATGTTATTTATTTAGCATAGACATTAAAAA

TAGCTCCTGGGAAA
Translation
MWDQRLVRLALLQQLRAVYGIKVKGGRGQCDRRRHETAATEIK - UNI32449 - GKVFGVPFNSLPHSVVPEFGHIPS - UNI32449 - SFLVD

ACASLKEHIHTEGLFRKSGSVVRLKALK SKLDQGEACLSSALPCDVAGLLKQFFRELPEPVLPADLHEALFKAQQLGAEERNKATLLLSCLMANPTVDI

LRYFFNFLKSVSLR RASENKMDSSNLAVIFAPNLLQTSEGHEKMSANTEKKLRLQAAVVQTFIDCASDIG GRVPDFILEKIPAMLGIDGLCTTPSLEG

FEGDFETPGECKRKRRQSVGD DFVNGALNKLKSSRTPSITPQQDRTA AQASASPLILTPSVKRKLPGESSHAFSSKKRKSIKHNLNFELLPSHFFSSN

STPVSV VHLDTSPDGSSQTSLSPIAMSGNHLVSTELRRSKRIASKKVYR RVESGKAGCFSPKVSRKEKTRRSLRLKFSLGKNRDS AQKRSANLRNTC

Transcript ENSMUST00000110947
Sequence
GGTGGAAGTGAAACAAGAGTGAAGAGAGGCGCGAGAGAAGAAGGTCTGTGTAAGTGGATCGAGGGAAAGTGGAGGAAGAGTGCCAGAGGTGGCTGGAAGG

CAGCGGAGCAGAGCGAGCCTGAGGGCGTTTGGCAAGTGGAAGAGTTGGTTGGTGGCAAAGAAAGTCAGGACCCGGAGTCGGCCTCGGAGAGTAGGCGACG

TGTTCGGGATGTGGGATCAGAGACTGGTCAGATTGGCCCTGCTGCAGCAGCTTCGAGCTGTCTATGGCATTAAGGTCAAGGGTGGCCGCGGTCAGTGCGA

TCGCAGGAGACATGAAACTGCAGCTACGGAAATAAAG - UNI32449 - GGTAAGGTATTTGGAGTACCCTTTAATTCCTTGCCTCATTCAGTCGTTC

CAGAATTTGGACACATTCCAAG - UNI32449 - CTTTCTTGTTGATGCGTGCGCATCTTTAAAAGAGCATATTCATACAGAAGGGCTTTTTAGGAAG

TCGGGGTCTGTTGTTCGTCTAAAGGCACTAAAG AGTAAACTGGATCAAGGTGAAGCCTGCCTGTCTTCTGCACTTCCGTGTGATGTTGCAGGCCTGCTT

AAGCAGTTCTTCCGGGAATTGCCAGAGCCTGTCCTCCCAGCTGATCTGCATGAAGCACTTTTCAAAGCTCAGCAGTTAGGAGCAGAGGAGAGGAATAAAG

CTACATTGTTGCTGTCGTGTCTTATGGCAAACCCTACAGTTGATATATTAAGATACTTCTTTAACTTTCTTAAGAGTGTTTCTCTTAG GGCAAGTGAGA

ATAAAATGGACAGCAGCAATCTTGCAGTAATATTTGCACCAAATCTTCTTCAGACAAGTGAAGGCCATGAGAAGATGTCTGCCAACACAGAGAAGAAGCT

ACGTCTGCAGGCAGCAGTAGTGCAGACTTTTATTGACTGTGCATCAGACATTG GACGAGTGCCAGATTTTATCCTGGAAAAGATACCAGCCATGTTAGG

TATTGATGGACTCTGTACTACTCCATCCCTGGAAGGCTTTGAAGGAGACTTTGAAACTCCTGGTGAATGTAAGAGAAAAAGAAGACAAAGTGTTGGAG A

TTTTGTGAATGGAGCCCTAAATAAACTTAAATCTAGCAGAACACCCTCTATTACACCTCAACAAGATAGGACAG CTCAGGCCTCTGCATCACCATTGAT

TCTCACCCCGAGTGTTAAGCGTAAACTGCCAGGAGAGTCTTCTCATGCTTTCTCGAGTAAGAAAAGGAAATCCATCAAGCACAACTTGAACTTTGAGCTG

TTGCCAAGTCATTTCTTCAGCAGCAATTCTACACCAGTATCAG TTCACTTAGATACAAGTCCTGACGGATCATCTCAGACTTCTCTCTCACCAATCGCC

ATGAGTGGAAACCACTTGGTCAGTACAGAATTAAGGCGAAGTAAAAGGATTGCCAGCAAAAAAGTTTACAG GGTAGAGTCAGGAAAAGCGGGCTGCTTC

TCTCCCAAAGTCAGTCGTAAAGAAAAGACCCGAAGATCTCTCCGTCTGAAATTTAGTCTGGGGAAGAACAGAGATTCA GATGGATGTTCTGTCATCAAT

AGATATGAAAATGTTGGTCGACGACTAGCGAATCAGCAAAATCTAAAAAGTAGGATTGATTCTGTAAAGACAGGCCTGCTTTTTAGCCCAGATATTGATG

AAAGATTGCTAAAGAAAGGTACATTTACACAATACTGTTAGAATTTAACCTCAAATTCTTGTATCTGTTTCTTTAAGGCAAAGTATACTATTTTGTGTTC

TGGAAGTTTAAAGTTCTCATTTGAATGGTGAAAAGTATTTGACTTGGCAGTGTAGCTTTCTGTTAGTATCTGGGGGATGCGTGTGAGTATCAGCACTGTA

CAGTTTTTACCTTAAATTATAGCATCCTCAGTGTTCTGGAAACAATGCTCAGTAACTTTGTTATATGTTCGGAATATATTTCAAAACTAGGCAAGATGTA

AGGTATTAAAAAGCATTAACTGCTTTATTTTAGGCTCAGAAAAGATCAGCAAATCTGAGGAACACTTGTTAACTCCAGATCAACTAGATGGAACAGGTTA

CCGGATGTCTTGGACAGAACCCAGTAATTCAAGTTTTCAAGACATGAGTGCAAATGGAACTTCTCCAATAATGCAAAATCTTGAGGTGAAGAGCTTTTCT

TTGGAGCCCGACATTACTGTTGAAAAATCACCAGTTGTGTCCTGTGAGCTCAGGCCTTCCACCTTCCATAGCCAGCCTGACAGCAGTGTGCTGTCTCTTA

GTGGGGATGAAGGGAACCTGGCCTCCGAGACCTTGCAGAAGATTCAGAAAGCATTTTCCGAATCTGGGAGTGATCTTCATATGGTGATAAATCATGAGCA

GTCATCAGTAACAAATACGGGGGAAGAAGTGGAATTCAGAGATGTGACTGTGACTGAGTCAAAGGGACATGATGGGAGCTGTGCTGGGGAGGAGGAGAAC

TGTCCTTCAGAACGGAATTTCTCACCGGATCAAAGCCCAGAGTTTGCCAGAGAAGCTGATGAGGAATGTTACTCAACTCAGATGAAGGTGGAATGTGAAG

GCCTGCACTCAGAAACACCCAAAGCTGACCCCCTCATCCTGCAAGCATTCCCCGGTGAGGAGCCAGCTGAGGAACCACAGTCCCCAAGGAACCAGCTAAG

CACTCCATCACGGGGGAATGAGAATGGGGGGGAGAGCGCTGGGGCAAGTGGAGCTCCCGGAGAAGATGAGAGCACGTGCAGTGTGGCGGTCCTTTCGAAA

CCTCGGCCCCAGAGACTTTCGAGGCAACAGTCACTGGTGGAAAAATGTGATAGTGTAGCTCCTGGGGCTCTACAAGTGACAGAGCACGGGAAGGTTTCTG

ATCACATACAGTGGTTTAATAAACTTTCTCTAAATGAACCGAACAGAGGAAAAGTGAAGTCACCTCTTAAATTTCAGCGTACTCCTGTCCGTCAGTCCGT

CAGAAGAATTAATTCTTTGTTGGAGTATGGCAGGCAGCCTGTGAGGCAGAAGTTGGCAATCTTTGGTGACGCAGCTTCTCCTCTCGTTAAATCAGTGAGC

TGTGACAGTGCCCTTCCCTCTTGTGTACAAAACACATCAAAAGGTCCCACTGCTCCACTTATCACGTCAGGCCTCGAAGCACAGAAGTCTACGTCTTGTA

ATAAATCAAGTGTTGAGTTAACTTCTAAATCTTTC
Translation
MWDQRLVRLALLQQLRAVYGIKVKGGRGQCDRRRHETAATEIK - UNI32449 - GKVFGVPFNSLPHSVVPEFGHIPS - UNI32449 - SFLVD

ACASLKEHIHTEGLFRKSGSVVRLKALK SKLDQGEACLSSALPCDVAGLLKQFFRELPEPVLPADLHEALFKAQQLGAEERNKATLLLSCLMANPTVDI

LRYFFNFLKSVSLR RASENKMDSSNLAVIFAPNLLQTSEGHEKMSANTEKKLRLQAAVVQTFIDCASDIG GRVPDFILEKIPAMLGIDGLCTTPSLEG

FEGDFETPGECKRKRRQSVGD DFVNGALNKLKSSRTPSITPQQDRTA AQASASPLILTPSVKRKLPGESSHAFSSKKRKSIKHNLNFELLPSHFFSSN

STPVSV VHLDTSPDGSSQTSLSPIAMSGNHLVSTELRRSKRIASKKVYR RVESGKAGCFSPKVSRKEKTRRSLRLKFSLGKNRDS DGCSVINRYENV

GRRLANQQNLKSRIDSVKTGLLFSPDIDERLLKKGTFTQYC

For any suggestions or comments, please send an email to unitrap@crg.es