Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041278 (Ttc1)
Chromosomal location
Chr 11: 43543014 - 43561510 (-)
Description
tetratricopeptide repeat domain 1 Gene [Source:MGI (curated);Acc:Ttc1-001]
RefSeq_dna
NM_133795 
RefSeq_peptide
NP_598556.1 
UniGene
Mm.271974 Mm.398436 
MGI
MGI:1914077 
Uniprot/SWISSPROT
Q91Z38 
Uniprot/SPTREMBL
A2AJK8 Q9CTZ9 Q3TDF3 
Human Ortholog
ENSG00000113312 (TTC1)
Omim not available
UniTrap UNI19575
Vector Insertion
Chr 11: 43558586 - 43558950
Public Clones not available
Private Clones OST388647 (lexicon) OST141503 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35497
Vector Insertion
Chr 11: 43558586 - 43561485
Public Clones IST10543A7 (tigm) IST14333F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38649
Vector Insertion
Chr 11: 43555262 - 43558950
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9619
Vector Insertion
Chr 11: 43553332 - 43555262
Public Clones RRB166 (baygenomics) W077E07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14911
Vector Insertion
Chr 11: 43543510 - 43549976
Public Clones PST5861-NR (escells) PST5861-NL (escells)
Private Clones OST355874 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109278
Sequence
AGGAGGAAGTAGAAGGACTCGGAGGCAGGAGCGGTGGAGAGAGGAGCTGGGAGGTTGTGAAGCCCATCGTGGGTCTCGCGGCGTTCG - UNI19575 -

 - UNI35497 - ACATTTAGCCGTACCTCCCTCCCTGAACTCAGCATGGAGGAAAAGTCAGAAGACTGTAAGGTCCCAGAAGATCTGTTCAATGGTCT

GAAAGTCGCAGATCCTCAAGAAGGAGAGTCTGCCAGCCCCATGGTTTCTGATCCCAAGGGTCAGCACTGCCAGAGCAAGCTGCCGAAGGCTGCTGAAGCC

CATCCACAGGACGACCATGTTGAAGAGGAATGTTTTCATGACTGTAGTGCCTCGTTTGAGGAGGAACAGCCAGGGGCGCACGTGGCAGGGAGCAAAGCCA

GCGATGATTCTAGTTCTGAACTGGATGAAGAATACCTAATTGAACTGGAAAAAAACATGCCAGAAGAAGAGAAACAG - UNI19575 - - UNI3549

7 - AAAAGAAGAGAGGAGAGCGCTAAACTAAAGGAGGAGGGGAATGAGCGGTTTAAGAGAGGAG - UNI9619 - ATTACATGGAAGCTGAGAGTTC

TTACAGTCAAGCCCTTCAGATGTGCCCAGCCTGTTTCCAGAAAGATCGATCTGTTCTGTTTTCAAATAGAGCTGCTGCGAGGATGAAACAG GACAAGAA

GGAGACGGCCATCACTGACTGCAGCAAAG CAATTCAGTTAAACCCCACCTATATCCGTGCAATACTGAGGAGAGCTGAATTATATGAGAAAACAGACAA

ACTAGATGAAGCACTGGAAGATTATAAATCAGTATTAGAAAAAGATCCATCAGTACATCAAGCAAGAGAAGCTTGTATG - UNI14911 - AGATTAC

CTAAGCAAATTGAAGAACGTAATGAAAGGTTAAAAGAGGAGATGTTAGGTAA - UNI14911 - GTAAACTAAAAGATCTTGGCAACTTGGTTCTGCG

ACCTTTTGGGCTCTCCACAGAAAATTTCCAGATCAAGCAGGATTCTTCTACTGGCTCCTACTCCATCAATTTTGTTCAAAATCCGAATAATAATAGATAA

CAGAAATAACAGTCTTAAAGGCTGACTGGGAGGCCATGAACTGTTCACAAGGAGCACGGCTCTGCAGGCGTTGAATATTTAAAAGCATCTATCTAAGAAA

GGCTGTGTAGTAGAACCAGAGGCGCCTTCTTGCTCTTGTTTTATGATCAGGGTGGAATGTGCCTCCTGATGTATGAGCCTCATTAATTTCCATTTTAAGG

TGGTGTCTGTGCAGCCGTGTCCCTGGTTCTGGCTGTTTTCTGTCTGGTGGAGAAGCCTGCTTGTCAAAGCTGACCTCTTAGAGCCGCACAGATGTGCTAG

CCACCAAAAACCTCCTGTAACCATGCAAGCCTGTAGTTGAGTGATGACCATACATATGGACAGGGTCCCCTCCTGCTGTCCCTCCCTGCTCACACTTGCT

CAGATGCTGCAGTGCAGGGGCTTCAGCATTCTTGAGTTCCTCCGTGTTAATAAAAACATCCTGTGACAGTTGGGGACTATGTTGTTAATTTTGTCCCCTT

AACAGCAGCTGAAGCAGATTCTATATGACATTTGGAACCAGTTCTGGTTTCCATCGAGGTCACTGATTCTGAAGCCCACAAAGCTAAAGTTTTTGCTGCT

TGACTCTCCCTTGAATAACCGATCAGTGTGCCAGAATTGAAGACTCCTGCTTCACAGGGCAGCTGAGTCAGTCTCCAGTTTTGTGAAATTAGCGGTTCTG

ACCAAGCATCAGTGCTAATCTCAGCTTAAAATGCCATCATTCAGAATGGTTTGTCTCCAAACAGCCTGTCTGTGTAGGCTGCATGAAGGCACAAGTTTCC

AGGAGAGGTTTTTGTTTACCTAGGTATCTGTTGATGCTAGTTTTCAGTCAGTGTCAGTGACATGTGTGCCTTATTTTGCAGATGAGCTGCCATGTTATTT

TGTGAGCTGTGTGTGACAACTGTTCTAGAACTTATGTGCGTCAATATCGAGTAGCTTTTGGC
Translation
 - UNI19575 - - UNI35497 - MEEKSEDCKVPEDLFNGLKVADPQEGESASPMVSDPKGQHCQSKLPKAAEAHPQDDHVEEECFHDCSASFEEE

QPGAHVAGSKASDDSSSELDEEYLIELEKNMPEEEKQ - UNI19575 - - UNI35497 - KRREESAKLKEEGNERFKRGD - UNI9619 - DY

MEAESSYSQALQMCPACFQKDRSVLFSNRAAARMKQ DKKETAITDCSKA AIQLNPTYIRAILRRAELYEKTDKLDEALEDYKSVLEKDPSVHQAREAC

M - UNI14911 - RLPKQIEERNERLKEEMLGK - UNI14911 - K
Transcript ENSMUST00000048578
Sequence
AGGAGCGGTGGAGAGAGGAGCTGGGAGGTTGTGAAGCCCATCGTGGGTCTCGCGGCGTTCG - UNI19575 - - UNI35497 - ACATTTAGCCGT

ACCTCCCTCCCTGAACTCAGCATGGAGGAAAAGTCAGAAGACTGTAAGGTCCCAGAAGATCTGTTCAATGGTCTGAAAGTCGCAGATCCTCAAGAAGGAG

AGTCTGCCAGCCCCATGGTTTCTGATCCCAAGGGTCAGCACTGCCAGAGCAAGCTGCCGAAGGCTGCTGAAGCCCATCCACAGGACGACCATGTTGAAGA

GGAATGTTTTCATGACTGTAGTGCCTCGTTTGAGGAGGAACAGCCAGGGGCGCACGTGGCAGGGAGCAAAGCCAGCGATGATTCTAGTTCTGAACTGGAT

GAAGAATACCTAATTGAACTGGAAAAAAACATGCCAGAAGAAGAGAAACAG - UNI19575 - - UNI35497 - AAAAGAAGAGAGGAGAGCGCTA

AACTAAAGGAGGAGGGGAATGAGCGGTTTAAGAGAGGAG - UNI9619 - ATTACATGGAAGCTGAGAGTTCTTACAGTCAAGCCCTTCAGATGTGCC

CAGCCTGTTTCCAGAAAGATCGATCTGTTCTGTTTTCAAATAGAGCTGCTGCGAGGATGAAACAG GACAAGAAGGAGACGGCCATCACTGACTGCAGCA

AAG CAATTCAGTTAAACCCCACCTATATCCGTGCAATACTGAGGAGAGCTGAATTATATGAGAAAACAGACAAACTAGATGAAGCACTGGAAGATTATA

AATCAGTATTAGAAAAAGATCCATCAGTACATCAAGCAAGAGAAGCTTGTATG - UNI14911 - AGATTACCTAAGCAAATTGAAGAACGTAATGAA

AGGTTAAAAGAGGAGATGTTAG - UNI14911 - GTAAACTAAAAGATCTTGGCAACTTGGTTCTGCGACCTTTTGGGCTCTCCACAGAAAATTTCCA

GATCAAGCAGGATTCTTCTACTGGCTCCTACTCCATCAATTTTGTTCAAAATCCGAATAATAATAGATAACAGAAATAACAGTCTTAAAGGCTGACTGGG

AGGCCATGAACTGTTCACAAGGAGCACGGCTCTGCAGGCGTTGAATATTTAAAAGCATCTATCTAAGAAAGGCTGTGTAGTAGAACCAGAGGCGCCTTCT

TGCTCTTGTTTTATGATCAGGGTGGAATGTGCCTCCTGATGTATGAGCCTCATTAATTTCCATTTTAAGGTGGTGTCTGTGCAGCCGTGTCCCTGGTTCT

GGCTGTTTTCTGTCTGGTGGAGAAGCCTGCTTGTCAAAGCTGACCTCTTAGAGCCGCACAGATGTGCTAGCCACCAAAAACCTCCTGTAACCATGCAAGC

CTGTAGTTGAGTGATGACCATACATATGGACAGGGTCCCCTCCTGCTGTCCCTCCCTGCTCACACTTGCTCAGATGCTGCAGTGCAGGGGCTTCAGCATT

CTTGAGTTCCTCCGTGTTAATAAAAACATCCTGTG
Translation
 - UNI19575 - - UNI35497 - MEEKSEDCKVPEDLFNGLKVADPQEGESASPMVSDPKGQHCQSKLPKAAEAHPQDDHVEEECFHDCSASFEEE

QPGAHVAGSKASDDSSSELDEEYLIELEKNMPEEEKQ - UNI19575 - - UNI35497 - KRREESAKLKEEGNERFKRGD - UNI9619 - DY

MEAESSYSQALQMCPACFQKDRSVLFSNRAAARMKQ DKKETAITDCSKA AIQLNPTYIRAILRRAELYEKTDKLDEALEDYKSVLEKDPSVHQAREAC

M - UNI14911 - RLPKQIEERNERLKEEMLG - UNI14911 - GKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR

For any suggestions or comments, please send an email to unitrap@crg.es