Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041297 (Cdc2l5)
Chromosomal location
Chr 13: 17807568 - 17896836 (-)
Description
cell division cycle 2-like 5 (cholinesterase-related cell division controller) Gene [Source:MGI Symbol;Acc:MGI:1916812]
RefSeq_dna
NM_001081058 
RefSeq_peptide
NP_001074527.1 
UniGene
Mm.193924 Mm.415880 
MGI
MGI:1916812 
Uniprot/SWISSPROT
Q69ZA1 
Uniprot/SPTREMBL
Q3UF50 Q8BJK2 
Human Ortholog
ENSG00000065883 (CDC2L5)
Omim not available
UniTrap UNI23514
Vector Insertion
Chr 13: 17864792 - 17895271
Public Clones not available
Private Clones OST255435 (lexicon) OST233560 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22068
Vector Insertion
Chr 13: 17856928 - 17858269
Public Clones not available
Private Clones OST309575 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32863
Vector Insertion
Chr 13: 17854937 - 17856928
Public Clones IST10072A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30728
Vector Insertion
Chr 13: 17843504 - 17855109
Public Clones IST11684H7 (tigm) IST14307B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20820
Vector Insertion
Chr 13: 17831027 - 17842090
Public Clones not available
Private Clones OST351185 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3628
Vector Insertion
Chr 13: 17820018 - 17830750
Public Clones BC0124 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042365
Sequence
CCCGACGTCAGGACGATGGAGTGAAGCGCGGCCCGCGGTGGCACTTCCGCGTTGCGCCGCCGGAGCCCGAGGCCGCCGCCGCCGCCGCCACCGCCGCCGC

CCGGCACGGCCGGCTTTCCGCCGAGGATAGGATCCTCCCGCGCCAGGCCCTGACGCCGCTGCGCACACACCGCGACTGGAACCGGGGACGCGCGTCCCGA

CCCGGATTATCGTGGCGCGACTCCCGGCCGGCCCTGCTGCTCGCTACCCCTCCGCCGCGGCTGCCGTCCCCCTTCCCGGCGGGGGACATGGCCAGGGTCT

GACCCCGGAGGAGGCCGCACCCGCGCCGCACTCTGCGGCGGGCTCTAGGCGATGCCGAGTAGCTCGGACACGGCGCTGGGGGGAGGCGGGGGCCTGAGCT

GGGCCGAGAAGAAGTTGGAGGAGCGCCGCAAGCGGAGGCGATTCCTGTCCCCTCAGCAGCCGCCGCTGCTGTTGCCGCTCCTGCAGCCGCAGCTCCTGCA

ACCGCCGCCGCCCCCGCCGCCTCTGCTCTTCCTGGCTGCCCCCGGCGCGGCCGCCGCCGCAGCCGCCGCCGCCGCGGCCTCCTCCTCTTGCTTCAGCCCG

GGCCCTCCTCTGGAGGTCAAGCGGCTGGCGAGAGGCAAGAGGCGCCCCGGAGGGCGGCAGAAGCGGCGCCGCGGGCCCCGCGCCGGGCAGGAGGCGGAGA

AGCGCCGGGTCTTCTCGCTGCCCCAGCCGCAGCAGGACGGCGGTGGCGGTGCCAGTAGCGGCGGGGGTGTGACCCCGCTGGTGGAGTACGAGGATGTGAG

CTCCCAGTCCGAGCAGGGGCTGCTGCTGGGGGGCGCCAGCGCGGCAACGGCGGCGACGGCTGCCGGGGGAACGGGGGGCAACGGCGGGAGTCCGGCCTCC

TCCTCCGGCACGCAGAGGCGCGCGGAGGGGTCGGAGCGCAGGCCGCGCCGGGACCGCCGCAGCAGCAGCGGCCGCAGCAAGGAGCGCCACCGCGAGCACC

GGCGGCGGGACGGGACGCGCAGCGGCAGCGAGGCCTCAAAGGCCCGCAGCCGCCACGGACACAGCGGCGAGGAGCGGGCGGAGGCCGCCAAGAGCGGCAG

CAGCAGCAGCAGCGGCGGCCGCCGCAAGAGCGCGTCGGCTACGTCCAGCAGCAGTAGCAGCCGCAAGGACCGGGACCTCAAGGCCCACCGCAGCCGGACT

AAGTCGTCCAAGGAACCGCCCTCGGCCTACAAGGAGCCGCCCAAGGCCTACCGGGAGGACAAGAGCGAGCCGAAGGCCTACAGGCGGCGGCAGCGGTCCC

TGAGCCCGCTGGGAGGCCGGGACGAAAGCCCGGTGTCCCACAGGGCCTCGCAGAGCCTTCGGAGCCGCAAGTCCCCCAGTCCGGCGGGAGGTGGCAGCAG

TCCTTATTCCCGGCGGCTGCCGCGCTCCCCGAGCCCCTATAGCCGGCGCCGCTCGCCCAGCTACAGCCGCCACAGCTCCTACGAGCGGGGCGGCGACGTA

TCCCCCAGCCCGTACAGCAGCAGCAGCTGGCGGCGCTCGCGCAGCCCCTACAGCCCAGTACTCAG - UNI23514 - ACGATCTGCCAAATCCCGAAG

CAGAAGCCCATATTCATCTAGGCACTCAAGATCTCGGAGCAGGCACAGATTGTCTAGATCAAGAAGTCGTCATTCAAGCATTTCTCCTAGCACACTAACT

CTGAAGAGTAGCTTGGCAGCTGAATTGAACAAGAATAAAAAGGCACGAGCTGCAGAGGCAGCAAGAGCTGCAGAGGCAGCAAAAGCTGCAGAAGCTGCTA

AGGCTGCTGAAGCAGCTGCCAAAGCTGCCAAAGCCTCAAATGCTTCTACACCTACCAAGGGGAACACAGAAACTGGTGCCAGTGTCTCACAGACAAACCA

TGTGAAGGAAGTCAAAAAACTTAAAACTGAGCATGCACCTTCTCCTTCAAGTGGTGGGACCGTCAAAAGCGACAAAGCAAAAACAAAGCCACCGCTTCAA

GTAACAAAGGTAGACAATAATTTGACAGTAGAGAAAGCCACCAAGAAAACAGTTGTTGGGAAGGAGAGTAAACCTGCTGCTACAAAGGAAGAACCAGTTT

CCACTAAAGAGAAAAGCAAGCCACTCACACCAAGCACAGGAGCCAAGGAGAAGGAGCAGCATGTGGCTTTAGTGACCTCTACGTTACCGCCATTACCTTT

GCCTCCCATGCTGCCTGAAGATAAAGATGCTGATAG CTTAAGAGGCAACATTTCTGTCAAAGCAGTTAAAAAAGAAGTAGAAAAGAAACTCCGATGTCT

GCTTGCTGATTTACCATTGCCCCCTGAGTTACCAGGAGGAGATGATCTTTCCAAGAGTCCAGAGGAGAAGAAAACAGCAGCACAGTTACATAGCAAACGA

AGGCCTAA - UNI22068 - - UNI32863 - AATATGTGGGCCTCGCTATGGTGAAATCAAAGAAAAAGATATTGACTGGGGGAAACGCTGCGTGG

ATAAATTTGATATCATCGGAATTATTGGAGAAGGTACTTATGGACAAGTTTACAAAGCCAGGGACAAAGACACGG - UNI30728 - - UNI32863 

- GAGAAATGGTAGCCTTAAAGAAAGTACGTCTGGATAATGAAAAGGAGGGTTTCCCAATTACAGCAATTAGAGAAATTAAAATTCTTCGGCAACTCACC

CACCAGAGTATCATCAATATGAAGGAAATCGTGACTGATAAAGAAGATGCTTTGGATTTTAAGAAAGACAAAG - UNI30728 - - UNI32863 - 

GTGCATTTTACCTGGTGTTTGAATATATGGACCATGATCTGATGGGACTGCTGGAATCAGGCTTGGTTCATTTTAATGAAAACCATATAAAATCTTTTAT

GAGACAGCTCATGGAAGGCCTGGATTATTGTCATAAGAAGAACTTTTTGCATAGAGATATTAAATGTTCAAATATCCTTCTAAATAATAG - UNI3072

8 - AGGACAGATAAAACTTGCAGATTTTGGACTTGCTCGTTTATATAGCTCAGAAGAAAG - UNI20820 - TCGCCCATATACTAACAAGGTCATT

ACTTTGTGGTATCGTCCACCTGAATTGCTCTTGGGAGAAGAACGATATACACCAGCCATTGATGTATGGAGCTGTGG ATGTATCCTTGGTGAACTCTTC

ACTAAAAAACCTATATTTCAAGCAAACCAGGAACTTGCACAGCTAGAGCTAATAAG - UNI3628 - CCGTATATGTGGGAGTCCATGTCCTGCAGTG

TGGCCTGATGTAATCAAACTGCCATATTTCAACACCATGAAACCAAAGAAGCAATATCGGCGGAAGTTAAGAGAAGAATTTGTTTT CATCCCCGCAGCT

GCACTCGACTTATTCGATTACATGCTTGCCTTGGATCCCAGTAAGCGCTGCACTGCTGAGCAGGCTCTTCAGTGTGAGTTCCTGCGAGACGTGGAACCCT

CCAAAATGCCTCCACCAGA CCTTCCTTTGTGGCAAGATTGTCATGAATTATGGAGTAAAAAGAGAAGAAGACAGAAACAGATGGGCATGACTGATGATC

TTTCCACAATCAAAGCCCCTAGGAAGGACCTGTCTCTGGGCTTAGATGACAGCAGAACTAACACACCCCAGGGTGTGCTGCCACCCGCACAGTTGAAATC

TCAGAGCAACTCAAATGTAGCACCTG TAATAACAGGCCCTGGACAGCCGTTAAACCACAGTGAATTGGCAATTCTTCTAAACCTACTACAATCTAAATC

AAGTGTTAATATGGCTGATTTTGTCCAAGTGTTGAACATTAAGGTAAACTCTGAGACTCAACAGCAGCTAAATAAAATAAACCTTCCTGCTGGAATTTTG

GCAACAGGTGAAAAACAGACAGATCCATCAACACCACAACAGGAGTCTTCAAAATCATTGGGAGGAGTTCAGCCTTCACAGACCATCCAGCCTAAAGTGG

AAACTGATGCTGCCCAGGCTGCTGTGCAGAGTGCATTTGCAGTCCTCTTGACTCAGTTAATAAAGGCCCAACAGTCCAAACAGAAAGATGCCATGCTAGA

GGAAAGGGAAAATGGATCAGGACATGAAGCTCCATTGCAACTCAGGCCTCCTCTAGAACCGAGCACTCCTGGATCCG GGCAAGATGACCTCATCCAGCA

CCAAGACAGGAGGATATTGGAGCTGACACCAGAACCAGACCGGCCTCGAATTCTGCCTCCTGATCAACGGCCTCCTGAACCTCCTGAACCACCACCAGTT

ACTGAGGAGGACCTAGATTATCGGACAGAAAACCAGCATGTTCCTACCACTAGTTCTTCATTAACTGACCCACATGCTGGAGTGAAGGCAGCCCTCTTAC

AGCTGCTTGCTCAGCATCAGCCCCAGGATGATCCCAAAAGAGAAGGTGGTATCGATTATCCCACAGGAGACACATATGTGCCCAGTTCAGACTATAAGGA

CAACTTTGGATCTTCTTTCTCTGCCGCTCCTTACGTTAGCAGTGATGGTCTAGGAAGTAGCTCCGCTGCTGCACCATTGGAAGCACGTAGTTTCATTGGA

AACTCAGATATTCAGTCTCTGGATAACTACAGTACTGCTTCATCTCACACTGGTGGTCCACCTCAAACTTCTGCCTTTACTGAGTCGTTTGCCAGTTCAG

TAGCTGGATATGGAGACATTTACCTCAATGCTGGTCCCATGTTGTTTAGTGGAGACAAGGACCATAGATTTGAATATAGCCATGGTCCTATCACAGTCCT

CACAAACAGCAATGACCCTTCCACAGGGCCAGAGAGTACTCATCCCTTGCCAGCAAAGATGCACAACTATAACTATGGTGGTAACTTACAGGAAAATCCA

GGTGGCCCTAGCCTCATGCATGGACAGACCTGGACTTCTCCTGCCCAAGGACCTGGATATTCACAAGGATACAGGGGACACATTAGCACATCAGCTGGCA

GAGGTCGAGGCAGAGGGTTACCATACTGAGTATCTGTTTTTCCTCAGGCACATCATTTTTATCTGGAAAGACTTTTCTAGCTGCAATTTCAGGCAGCAAT

CCAAGAGACTTGAATAATATTAATTCAACAACAGCTTTATTTTTATGTGGAAAGGGTCTTGCATACAATAGTGAAAAAAACAAAACAACAAAAAAAATCT

TTGCTTAAATTCATGCTGTTCTTAAAACTAGCTCTATTGATTGTACATCGTCACAGATTTTAGTTAACAATTTTATTTTGTATTCTTGCAGTTTTAAGTG

GATGCTAACATTAGGGACATAATGTTTTTATGGCCCTGTGGCAGATCTTCTGAACTATGCACACTTGTGCTTTTTTTTGTAAGTTTGGACCAACTTTTAT

GTAAACAAGCTCCCCTTCCCCCCATGCCCCCCATCCCCCTTCCAGTTTTACAACAATCAGAAAGGGCACTGATTTATTTGGTATTTTCTTTTTACAAAGC

TACCTTTAGTCGAAGGTCACTGTCAGTCTTTGCACCTGCTTTCAGTGTTATTGTGAAAGGTGTACTTTGTGCTCATTTCAGAAAAATAAAACACAACCTT

TCTCTTGATGCAACAGTTTTATATAAAAAATGGTCAACATTATTTTTGTTTTGTTTTTTTCAGGTTACCATAATACAGGAAAATTCATTCAAATGAAATA

GTGGTTTTTATATGAAAACTATGGGTAGGGTGGGGAGGGGTTGAGTAAGTGCCTTAACAGGTAAGCTTAAGGTCTGCGGATGAAATGAGCCTTCACACCA

CTGTCTTTCTAAGGGAGTCTGTACTGTGCTGACGGGGCAGGGAGCTTCTCCGCTCTCAGGAGTTGCTTGGTCAGTTCTGTTAGCTCCATTCCCTCTGCCT

GCCTGTCACACTGTCCCTTTCTGCCTGTCTTTTGGCTGTGTTGACTTCCACTGTTACCTTCTCTTGGTAGGGGTGTAAGAGGAAAAGAAAGGGAGAACTC

AGAACCTTATGTTACTTCTGGGAAGTACTAAAACTTTTTTTTATCAATTAAGTGGTTGAAAGTAGTAGCTGAATGAGAATTTTAGAGTGCTCCTTTCTTT

CTGGCTGTCATACTGACCCAGTTTCTATTTGGAGGGCAGGAGTTTTGAAGCAAGTATGTATAACAATTCATAAATAAATACATATGGTACATAACAAATG

TATTGAAGTCCACAGAAGGAGGGTGGCAAACACCTTATTTTAAGTTATATAATTTTAAGAAAATGTCAACTTAAGTAGAAACATGTCCTAGATCTAATTT

AGTAAAGCAAACAGAAAACTCAAAGAGAAAACCTTCCCTCTTCCTTTCAATTCTGTGAAATTTACTATAATTTCTGCCAGATTAGAGCAGTGCTATTCTA

TTAGAATCAACCAAGAAAGAATAACTCTGATGTTGTCAAGTCGCACTATGTTTACGTTCACACACACACACACACACACACAAAAAACCAAAATTCTATT

TCTGAAAAGGAACCAAAGGTAAATAGCCAGCATCACCTTCATCATTCGTAGATAAGAGACTCTGGGGAACCGCCCTCGCGTGCCGACTGACAATTTCAAT

TGTTGTAGTACCTTTCCCATTGGATACTAAGTAAGGAAGAACTGTTATGAAAAGCAGCTTAGCTTCATGCCCTTTATATGATTTGTGACCCTGCATTTAC

AAACATTCAGGAAACATTATTGTTTGGTGACAGAATATTTTAAAGATAATTTTCCAGTTTATGCCTATTAAAAATGAGTTTTCAGTTGACCATTTTATTT

TTTGATCGTATTTTGTTGGTGAAAGAAAAAAATTAATGGAAGAAAAAATATTTTGCTTTTATTTGAATACAGAGTACTAACAACTTAATAAAACAGTAGA

GGAAGTGAAAAAATGTTTTGAAATTTAGAAATTAGAGTATTCAAGTCTCTGAAATTTTAATATGGTGAGTCTTAGAGCTTTAGACTTTCCTATAAGTGAC

AGTATCTAAATTATTATTTGTCACATTTGGTACATCTGCTGGCCATAAGCAGCTAACCTAAAATTGAAACTATTTATGTGACATGAATAGTCTGTGTTTT

AAAAATTAAATATTTTATATAAAATTGACTTGTGTTTGGATAGTTTTTCTAATTAAACATTTCAGATATATATATCCATGTTGGGAGAGTGGCTGGGAAG

TCAGGGAAATTATTGGCTTTGAAATAGAAAATTGGAACTATTTCTTCTAATAATGTGTGTTTTGTAAGACTGTGTAACTATATCCTGTGTTTAAGAAAAG

GGGATGCCAATTAAACCATAGTGAAGAAAGGCCAGTGACTGCAGGACAGTCCAGAC
Translation
MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLFLAAPGAAAAAAAAAAASSSCFSPGPPLEVKRLARGKRRPG

GRQKRRRGPRAGQEAEKRRVFSLPQPQQDGGGGASSGGGVTPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGNGGSPASSSGTQRRAEGSERRPRR

DRRSSSGRSKERHREHRRRDGTRSGSEASKARSRHGHSGEERAEAAKSGSSSSSGGRRKSASATSSSSSSRKDRDLKAHRSRTKSSKEPPSAYKEPPKAY

REDKSEPKAYRRRQRSLSPLGGRDESPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPRSPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPY

SPVLR - UNI23514 - RRSAKSRSRSPYSSRHSRSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEAAKAAEAAA

KAAKASNASTPTKGNTETGASVSQTNHVKEVKKLKTEHAPSPSSGGTVKSDKAKTKPPLQVTKVDNNLTVEKATKKTVVGKESKPAATKEEPVSTKEKSK

PLTPSTGAKEKEQHVALVTSTLPPLPLPPMLPEDKDADS SLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTAAQLHSKRRPK -

 UNI22068 - - UNI32863 - KICGPRYGEIKEKDIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTG - UNI30728 - - UNI32863 - 

GEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKG - UNI30728 - - UNI32863 - GAFYLVFEYMDHDLM

GLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNR - UNI30728 - RGQIKLADFGLARLYSSEES - UNI20820 - SRP

YTNKVITLWYRPPELLLGEERYTPAIDVWSCG GCILGELFTKKPIFQANQELAQLELIS - UNI3628 - SRICGSPCPAVWPDVIKLPYFNTMKPK

KQYRRKLREEFVF FIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPD DLPLWQDCHELWSKKRRRQKQMGMTDDLSTIKAPRKDLSL

GLDDSRTNTPQGVLPPAQLKSQSNSNVAPV VITGPGQPLNHSELAILLNLLQSKSSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGEKQTDPST

PQQESSKSLGGVQPSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDAMLEERENGSGHEAPLQLRPPLEPSTPGSG GQDDLIQHQDRRILELT

PEPDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYPTGDTYVPSSDYKDNFGSSFSAA

PYVSSDGLGSSSAAAPLEARSFIGNSDIQSLDNYSTASSHTGGPPQTSAFTESFASSVAGYGDIYLNAGPMLFSGDKDHRFEYSHGPITVLTNSNDPSTG

PESTHPLPAKMHNYNYGGNLQENPGGPSLMHGQTWTSPAQGPGYSQGYRGHISTSAGRGRGRGLPY

For any suggestions or comments, please send an email to unitrap@crg.es