Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041328 (Pcf11)
Chromosomal location
Chr 7: 99792222 - 99818443 (-)
Description
cleavage and polyadenylation factor subunit homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Pcf11-001]
RefSeq_peptide
NP_083354.2 
UniGene
Mm.469752 Mm.288645 Mm.397711 Mm.465990 
MGI
MGI:1919579 
Uniprot/SPTREMBL
Q80V88 A5HLW0 A5HLW1 B2RX07 Q6PCW0 Q8K0S1 Q8R2P5 Q99KH9 Q3TT32 Q3TTQ0 Q69ZY3 
Human Ortholog
ENSG00000165494 (PCF11)
Omim not available
UniTrap UNI14426
Vector Insertion
Chr 7: 99814249 - 99818145
Public Clones FHCRC-GT-S13-2G1 (fhcrc)
Private Clones OST456677 (lexicon) OST267717 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24750
Vector Insertion
Chr 7: 99812666 - 99814249
Public Clones not available
Private Clones OST207987 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19993
Vector Insertion
Chr 7: 99795033 - 99795437
Public Clones not available
Private Clones OST375724 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7853
Vector Insertion
Chr 7: 99793288 - 99794499
Public Clones RRP157 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107182
Sequence
ACATTTTCGGAGCTGGAGCCGCCACTGCCGCCGCCATTTTGTGTCT - UNI14426 - GGGGCCGCGGCGCAATGTCAGAGCAGACGCCGGCGGAGGC

CGGGGCTGCGGGGGCCCGGGAGGACGCCTGTCGGGATTATCAGTCGTCGCTGGAAGACCTGACCTTCAATAGCAAACCGCACATCAATATGCTGACCATT

CTAGCCGAGGAGAACCTGCCCTTCGCCAAGGAGATCGTCTCTCTCATCGAGGCCCAAACCGCCAAGGTTTTTATACACCCCGCAGCCTCCTATTCTTCTA

ATACTCCTTGATTTTAGTGTCAGCCTCATCCCAGGTCTCGCTTCCATCCGAAGGGGGACGGAGTTCCTCCTCTCCAACCCCCCACCCCCGACTCGGGCTT

GGTCTTTGGCCCCGGCTGGGAGCGTGGGCCTCTTTCGGGAGGGAGCGGGGAGGATGCAGGGTGGAGCCCCATTT
Translation
 - UNI14426 - MSEQTPAEAGAAGAREDACRDYQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEAQTAKVFIHPAASYSSNTP
Transcript ENSMUST00000119954
Sequence
TTTCGCACGACGCAGCGGTTGGGAACACAGACATTTTCGGAGCTGGAGCCGCCACTGCCGCCGCCATTTTGTGTCTGTGGAGAAAGAAGCCCCGGCGGCG

GCTGGAAGCGGACGGAGATTCCCCGTGAGGCTGCGGCGTTTCTTCCCCGAGGTTCCCCCTGGGTCGTCCCCCATCCCCCCTCCGTGGTCAGCATGTGGTG

AAGCCGCAGCCGCCGGAGACCCGGGGAGCGAGGCCGAGGCGTCGGAAGGGAGGCGGGGTGTCGAGCGGCTTCAGCTTCGGCGGCGGCGGACCTCGGAGGG

GGGCCGCGGCGCAATGTCAGAGCAGACGCCGGCGGAGGCCGGGGCTGCGGGGGCCCGGGAGGACGCCTGTCGGGATTATCAGTCGTCGCTGGAAGACCTG

ACCTTCAATAGCAAACCGCACATCAATATGCTGACCATTCTAGCCGAGGAGAACCTGCCCTTCGCCAAGGAGATCGTCTCTCTCATCGAGGCCCAAACCG

CCAAG - UNI14426 - GCTCCTTCCTCAGAGAAGCTTCCAGTTATGTACCTTATGGATTCTATCGTGAAAAATGTTGGAAGAGAATATCTCACTGCC

TTTACTAAAAATCTAGTTGCAACATTTATTTGTGTGTTTGAAAAG - UNI14426 - - UNI24750 - GTGGATGAAAATACTAGAAAAAGTTTAT

TTAAATTACGTTCCACATGGGATGAAATATTCCCTTTGAAGAAACTTTATGCCTTGGATGTCAGAGTCAATTCATTAGATCCTGCTTGGCCTATTAAACC

TCTGCCTCCTAATGTGAATACATCTAGCATCCATGTGAATCCCAAATTTTTAAATAAATCG CCTGATGAGCCTTCAACACCTGGCACAGTGGTCAGTTC

CCCCAGTATCTCCACTCCTCCCATTGTACCTGATATACAAAAGAATCTTACCCAAGAACAACTAATAAGGCAACAGTTACTGGCAAAACAAAAACAGTTG

TTAGAACTTCAGCAGAAAAAGCTGGAGCTTGAGTTAGAACAAGCTAAGGCACAGCTG GCAGTATCTCTGAGTGTTCAGCAGGAAACAGCCAACTTGGGT

CCTGGATCAGTGCCGTCTAAATTACATGTTCCACAAATTCCCACAATGGCTGTTAAAACTCCCCATCAGGTCCCTGTACAACCTGACAAAAGCCGAGCAG

GTCCATCCTTACAAATGCAAGACTTGAAAGGAACTAACCGGGATCCCCGTCTTAACAGGATGAGCCAACATTCTTCCCATGGCAAAGAGCAGAGTCATAG

GAAAGAATTTGTAATGAACACAATAAACCAGTCTGATATTAAAACAAGTAAGAATGTACCCTCTGAAAAGCTAAATTCATCCAAACAAGAAAAAAGTAAA

TCAGGTGAAAGAATAACCAAGAAAGAACTTGACCAGTTAGATTCTAAATCCAAATCTAAGTCTAAATCACCATCACCTTTGAAAAACAAATTATCCCACA

CAAAAGACTTGAAAAATCAAGACTCTGAAAGTATGAGGTTGTCTGATATGAGTAAGAGAGATCCACGATTAAAGAAGCATCTTCAGGATAAAGCTGAGGG

CAAAGATGAAGATGTAAAAGAAAAGAGAAAAACTGCAGAAAAGAAGGAGAAAGATGAGCACATGAAATCATCTGAACACAGGGTGATTGGAAGTAGAAGT

AAAATCATAAATGGCATTGTCCAAAAACAAGACATGGTTACAGAGGAGTTGGAAAAACAGGGGACAAAACCAGGGAGATCGAGTACTAGAAAGAGATCAA

GATCAAGGTCACCTAAGTCTCGGTCACCAATTATACATTCCCCAAAGAGAAGAGATAGACGGTCACCCAAACGAAGGCAAAGAAGTATGTCTCCCAATTT

GGCACCCAAAGCTGGAAAGATGCGTCAGTCGGGACTAAAACAGTCACATATGGAAGAATTCCCACCACCTTCCAGGGAAGAAAGAAATATTAAGAGAAGT

GCTAAGCAGGATGTTAGAGATCCCAGACGACTGAAAAAGATGGATGAGGACCGGCCTCAAGAAACTGCAGGTCAACATTCTATGAAGTCAGGTGGTGACC

CAAAGGAGAATATAGAGAATTGGCAAAGCTCTAAGTCTGCCAAAAGATGGAAATCTGGCTGGGAAGAAAATAAAAG CTTGCAGCAGGGTGATGAACATA

GTAAACCTCCTCATCTAAGGCATAGGGAGAGCTGGTCAAGCACTAAAGGGATCTTGTCACCTCGAGCCCCCAAGCAGCAGCACCGACTAAGTGTAGATGC

CAATCTTCAAATTCCTAAAGAGTTAACTCTTGCAAGCAAAAGAGAATTGCTTCAAAAG ACGAGCGAACGTTTAGCATCTGGTGAAATTACACAGGATGA

GTTCCTTGTTGTTGTGCATCAAATTCGACAGCTATTTCAGTATCAAGAAG GTGTACGAGAGGAGCAGAGATCACCATTCAATGATCGTTTTCCACTTAA

GCGACCTAGATATGAAGATTCAGATAAACCATTTGTAGATGGCCCAGCATCAAGATTTGCTGGCCTTGATACAAATCAGCGACTTACAGCTCTAGCTGAA

GACCGACCATTATTTGATGGACCTGGTAGGCCATCTGTGACGAGAGATGGCCCAGCCAAGATGATTTTTGAAGGACCTAATAAATTAAGCCCTAGAATTG

ATGGACCTCCTACACCAGGTTCTCTTCGGTTTGATGGGTCACCAGGACAAATGGGGGGAGGAGGCCCTATGAGATTTGAAGGACCACAAGGTCAGTTAGG

AGGTGGGTGTCCTTTGAGATTTGAAGGTCCTCCAGGACCAGTAGGAACACCTCTGCGGTTTGAAGGGCCAATTGGTCAAGGAGGAGGAGGTGGTTTTCGA

TTTGAAGGTTCACCTAGTTTGAGGTTTGAGGGATCTACAGGTGGTTTACGATTTGAAGGACCAGGGGGTCAGCCCGTGGGTGGTCTCAGGTTTGAAGGAC

ATCGTGGTCAACCTGTGGGTGGTCTCAGGTTTGAAGGACCTCATGGACAGCCTGTGGGCAGTCTTAGATTTGATAATCCTCGAGGTCAGCCTGTAGGAGG

ACTTAGATTTGAAGGGGGTCATGGTCCATCAGGGGCTGCAATTAGGTTTGATGGGCCTCATGGTCAGCCAGGTGGTGGTGGTGGTATCAGATTTGAGGGC

CCTTTGCTACAGCAAGGAGTTGGAATGAGGTTTGAGGGTCCCCATGGTCAGTCTGTAGCTGGTCTGAGATTTGAAGGACATAATCAACTAGGTGGGAACC

TTAGGTTTGAGGGACCACATGGTCAACCAGGGGTTGGGATCAGGTTTGAAGGACCTATAGTTCAACAAGGAGGTGGAATGAGGTTTGAAGGTCCTGTACC

AGGAGGTGGCCTGAGAATTGAAGGGCCTCTGGGTCAAGGTGGTCCTAGATTTGAAGGTTGTCACTCTTTAAGGTTTGATGGACAGCCAGGTCAACCATCA

CTTTTGCCAAGATTTGATGGATTACATGGCCAGCCAGGTCCTAGATTTGAAAGAACTGGTCAGCCAGGTCCACAGAGGTTTGATGGACCACCTGGACAGC

AGGTTCAACCAAGATTTGATGGTGTACCTCAAAGATTTGATGGGCCACAACACCAGCAAGCATCAAGATTTGATATTCCTCTTGGTCTACAAGGAACTCG

ATTTGACAATCATCCTTCACAAAGGATTGAATCTTTCAATCATTCTGGCCCATATAATGATCCACCTGGCAATACTTTTAATGTTCCATCTCAAGGATTA

CAGTTCCAAAGACACGAACAAATATTTGATACACCTCAAGGACCAAATTTTAATGGACCACATGGCCCTGGAAATCAGAATTTCCCAAATCCCATTAACA

GAGCTTCTGGACACTATTTTGATGAAAAGAATCTTCAGAGTTCTCAGTTTGGAAACTTTGGCAATTTGCCTACACCAATATCAGTAGGAAATATTCAGGC

ATCTCAACAG GTTCTTACTGGTGTTGCTCAGCCAGTAGCGTTTGGCCAAGGACAACAGTTCTTACCAGTTCATCCACAGAATCCTGGAGCTTTTATTCA

AAATCCTTCAG GCGGTCTTCCCAAGGCATATCCTGATAATCATCTCAGTCAGGTGGATGTAAACGAATTGTTTTCAAAACTGCTAAAAACAGGAATTCT

CAAATTGTCACAGCCTGATTCAGCTACAGCAC AGGTAACCGAGGCTGTTGCTCAGCCTCCCCCTGAGGAGGACGAGGATCAGAATGAAGATCAGGATGT

TCCAGATCTTACCAATTTCACCATTGAAGAATTGAAGCA ACGTTATGACAGTGTTATAAACCGGCTGTACACTGGGATTCAATGTTACTCGTGTGGAAT

GAGGTTCACGACATCCCAGACAGATGTTTATGCAGATCACTTGGATTGGCATTATCGGCAAAACAGAACCGAGAAAGATGTTAGCAGAAAAGTCACTCAT

AGACGTTGGTACTACAGTCTAACA GATTGGATAGAATTTGAAGAAATAGCTGATCTGGAAGAACGTGCAAAAAGCCAGTTTTTTGAAAAGGTTCATGAA

GAGGTTGTCCTTAAAACTCAGGAGGCTGCTAAAGAAAAGGAGTTCCAAAGTGTACCTGCTGGACCAGCTGGAGCAGTTGAG - UNI19993 - AGTTG

TGAAATCTGTCAAGAACAATTTGAACAGTACTGGGATGAAGAGGAGGAAGAATGGCACTTAAAAAATGCTATTAGAGTAGACGGAAAG ATTTACCATCC

ATCATGTTATGAAGATTATCAAAAT - UNI7853 - ACATCTTCATTTGATTGCACACCATCTCCCAGCAAGACACCAGTTGAAAACCCTTTGAACAT

TATGTTGAACATTGTCAAAAACGAATTGCAAGAACCCTGTGAAAGTCCCAAAGTTAAGGAAGAACAAATTGATGCCCCACCAGCTTGTTCAGAAGAAAGT

GTAGCAACACCCACTGAAATTAAAACAGAAAGTGATACAGTTGAGTCAGTTTAAATAAAATGAGAAAAGTATGCTTTTCTTTTTAAACAAAAGCTGCTGT

TGGATCTAGGTGAAGAATTTTTTTATGTATATATAGAAATATCTATATTAATTGTCTAGCTGTGGCAGGGCCTTCAGCTATCATTTGGTTAATAAATACA

TTTTAGTATTTGCATTTCCTACTGCCTGCACAGTTTCAGGTGCTTGTTGTGTGAAAGTTCTGTAGATGAGTGCAAATGTAACAAAATGAAATTGTATGTG

TACAAATGTACAATTTTCACTTGTGAACTGTAAATTATAAATAAAAAATATTTTTGCTATCCATGGAGTGTAATATTTATGCACACCATCAAATAAAGAC

AGTGTTTCTATACTTTTATTGGGCAAGAATGGAACTGAACAGCAATCTTAACATGATGGTTTTTTTTCTAGTAGCTTCCTGGGACTTAATGCAGCAAAGT

TTCAAACTTAGTTTTTCTCAAATAGAAAAGCAAGATTAAAAAAACAAAAAGGACATATGTGCTTACATATAGATATGTATCTCCAGCTAGAGTCATCCAC

AATGTCCACTTTTGGAAAGTATGTAATGAAACAGTAATGCTTATTTAAACTTGGACACTGATGCCATCAAGCAACTAACAAATATATTTAAGTACTAAAA

GTGATTTTACTTTTTAGAAAATATTTTTAAAATTGTCAATTTAATGCAGATGAACACATTTCTATTTTAAGTTACAGGGATTCTGTATAAGAATGTTCAT

ATGAAAAACATGGTTAACTTTTTTTCTTTGTTGGTTTTGATTGAATTAGATGGGTAACATGAGATGTTAATATTCATACATGTAATAAACTGAATGATGA

ACAA
Translation
MSEQTPAEAGAAGAREDACRDYQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEAQTAK - UNI14426 - APSSEKLPVMYLMDSIVKNVGR

EYLTAFTKNLVATFICVFEK - UNI14426 - - UNI24750 - VDENTRKSLFKLRSTWDEIFPLKKLYALDVRVNSLDPAWPIKPLPPNVNTSSI

HVNPKFLNKS PDEPSTPGTVVSSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQL AVSLSVQQETANLGPGSVPSKLH

VPQIPTMAVKTPHQVPVQPDKSRAGPSLQMQDLKGTNRDPRLNRMSQHSSHGKEQSHRKEFVMNTINQSDIKTSKNVPSEKLNSSKQEKSKSGERITKKE

LDQLDSKSKSKSKSPSPLKNKLSHTKDLKNQDSESMRLSDMSKRDPRLKKHLQDKAEGKDEDVKEKRKTAEKKEKDEHMKSSEHRVIGSRSKIINGIVQK

QDMVTEELEKQGTKPGRSSTRKRSRSRSPKSRSPIIHSPKRRDRRSPKRRQRSMSPNLAPKAGKMRQSGLKQSHMEEFPPPSREERNIKRSAKQDVRDPR

RLKKMDEDRPQETAGQHSMKSGGDPKENIENWQSSKSAKRWKSGWEENKS SLQQGDEHSKPPHLRHRESWSSTKGILSPRAPKQQHRLSVDANLQIPKE

LTLASKRELLQK TSERLASGEITQDEFLVVVHQIRQLFQYQEG GVREEQRSPFNDRFPLKRPRYEDSDKPFVDGPASRFAGLDTNQRLTALAEDRPLF

DGPGRPSVTRDGPAKMIFEGPNKLSPRIDGPPTPGSLRFDGSPGQMGGGGPMRFEGPQGQLGGGCPLRFEGPPGPVGTPLRFEGPIGQGGGGGFRFEGSP

SLRFEGSTGGLRFEGPGGQPVGGLRFEGHRGQPVGGLRFEGPHGQPVGSLRFDNPRGQPVGGLRFEGGHGPSGAAIRFDGPHGQPGGGGGIRFEGPLLQQ

GVGMRFEGPHGQSVAGLRFEGHNQLGGNLRFEGPHGQPGVGIRFEGPIVQQGGGMRFEGPVPGGGLRIEGPLGQGGPRFEGCHSLRFDGQPGQPSLLPRF

DGLHGQPGPRFERTGQPGPQRFDGPPGQQVQPRFDGVPQRFDGPQHQQASRFDIPLGLQGTRFDNHPSQRIESFNHSGPYNDPPGNTFNVPSQGLQFQRH

EQIFDTPQGPNFNGPHGPGNQNFPNPINRASGHYFDEKNLQSSQFGNFGNLPTPISVGNIQASQQ VLTGVAQPVAFGQGQQFLPVHPQNPGAFIQNPSG

 GGLPKAYPDNHLSQVDVNELFSKLLKTGILKLSQPDSATAQ QVTEAVAQPPPEEDEDQNEDQDVPDLTNFTIEELKQ QRYDSVINRLYTGIQCYSCG

MRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLT DWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVE - UN

I19993 - SCEICQEQFEQYWDEEEEEWHLKNAIRVDGK IYHPSCYEDYQN - UNI7853 - TSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPC

ESPKVKEEQIDAPPACSEESVATPTEIKTESDTVESV
Transcript ENSMUST00000040360
Sequence
CGCCACTGCCGCCGCCATTTTGTGTCTGTGGAGAAAGAAGCCCCGGCGGCGGCTGGAAGCGGACGGAGATTCCCCGTGAGGCTGCGGCGTTTCTTCCCCG

AGGTTCCCCCTGGGTCGTCCCCCATCCCCCCTCCGTGGTCAGCATGTGGTGAAGCCGCAGCCGCCGGAGACCCGGGGAGCGAGGCCGAGGCGTCGGAAGG

GAGGCGGGGTGTCGAGCGGCTTCAGCTTCGGCGGCGGCGGACCTCGGAGGGGGGCCGCGGCGCAATGTCAGAGCAGACGCCGGCGGAGGCCGGGGCTGCG

GGGGCCCGGGAGGACGCCTGTCGGGATTATCAGTCGTCGCTGGAAGACCTGACCTTCAATAGCAAACCGCACATCAATATGCTGACCATTCTAGCCGAGG

AGAACCTGCCCTTCGCCAAGGAGATCGTCTCTCTCATCGAGGCCCAAACCGCCAAG - UNI14426 - GCTCCTTCCTCAGAGAAGCTTCCAGTTATG

TACCTTATGGATTCTATCGTGAAAAATGTTGGAAGAGAATATCTCACTGCCTTTACTAAAAATCTAGTTGCAACATTTATTTGTGTGTTTGAAAAG - U

NI14426 - - UNI24750 - GTGGATGAAAATACTAGAAAAAGTTTATTTAAATTACGTTCCACATGGGATGAAATATTCCCTTTGAAGAAACTTTA

TGCCTTGGATGTCAGAGTCAATTCATTAGATCCTGCTTGGCCTATTAAACCTCTGCCTCCTAATGTGAATACATCTAGCATCCATGTGAATCCCAAATTT

TTAAATAAATCG CCTGATGAGCCTTCAACACCTGGCACAGTGGTCAGTTCCCCCAGTATCTCCACTCCTCCCATTGTACCTGATATACAAAAGAATCTT

ACCCAAGAACAACTAATAAGGCAACAGTTACTGGCAAAACAAAAACAGTTGTTAGAACTTCAGCAGAAAAAGCTGGAGCTTGAGTTAGAACAAGCTAAGG

CACAGCTG GCAGTATCTCTGAGTGTTCAGCAGGAAACAGCCAACTTGGGTCCTGGATCAGTGCCGTCTAAATTACATGTTCCACAAATTCCCACAATGG

CTGTTAAAACTCCCCATCAGGTCCCTGTACAACCTGACAAAAGCCGAGCAGGTCCATCCTTACAAATGCAAGACTTGAAAGGAACTAACCGGGATCCCCG

TCTTAACAGGATGAGCCAACATTCTTCCCATGGCAAAGAGCAGAGTCATAGGAAAGAATTTGTAATGAACACAATAAACCAGTCTGATATTAAAACAAGT

AAGAATGTACCCTCTGAAAAGCTAAATTCATCCAAACAAGAAAAAAGTAAATCAGGTGAAAGAATAACCAAGAAAGAACTTGACCAGTTAGATTCTAAAT

CCAAATCTAAGTCTAAATCACCATCACCTTTGAAAAACAAATTATCCCACACAAAAGACTTGAAAAATCAAGACTCTGAAAGTATGAGGTTGTCTGATAT

GAGTAAGAGAGATCCACGATTAAAGAAGCATCTTCAGGATAAAGCTGAGGGCAAAGATGAAGATGTAAAAGAAAAGAGAAAAACTGCAGAAAAGAAGGAG

AAAGATGAGCACATGAAATCATCTGAACACAGGGTGATTGGAAGTAGAAGTAAAATCATAAATGGCATTGTCCAAAAACAAGACATGGTTACAGAGGAGT

TGGAAAAACAGGGGACAAAACCAGGGAGATCGAGTACTAGAAAGAGATCAAGATCAAGGTCACCTAAGTCTCGGTCACCAATTATACATTCCCCAAAGAG

AAGAGATAGACGGTCACCCAAACGAAGGCAAAGAAGTATGTCTCCCAATTTGGCACCCAAAGCTGGAAAGATGCGTCAGTCGGGACTAAAACAGTCACAT

ATGGAAGAATTCCCACCACCTTCCAGGGAAGAAAGAAATATTAAGAGAAGTGCTAAGCAGGATGTTAGAGATCCCAGACGACTGAAAAAGATGGATGAGG

ACCGGCCTCAAGAAACTGCAGGTCAACATTCTATGAAGTCAGGTGGTGACCCAAAGGAGAATATAGAGAATTGGCAAAGCTCTAAGTCTGCCAAAAGATG

GAAATCTGGCTGGGAAGAAAATAAAAG CTTGCAGCAGGGTGATGAACATAGTAAACCTCCTCATCTAAGGCATAGGGAGAGCTGGTCAAGCACTAAAGG

GATCTTGTCACCTCGAGCCCCCAAGCAGCAGCACCGACTAAGTGTAGATGCCAATCTTCAAATTCCTAAAGAGTTAACTCTTGCAAGCAAAAGAGAATTG

CTTCAAAAG ACGAGCGAACGTTTAGCATCTGGTGAAATTACACAGGATGAGTTCCTTGTTGTTGTGCATCAAATTCGACAGCTATTTCAGTATCAAGAA

G GTGTACGAGAGGAGCAGAGATCACCATTCAATGATCGTTTTCCACTTAAGCGACCTAGATATGAAGATTCAGATAAACCATTTGTAGATGGCCCAGCA

TCAAGATTTGCTGGCCTTGATACAAATCAGCGACTTACAGCTCTAGCTGAAGACCGACCATTATTTGATGGACCTGGTAGGCCATCTGTGACGAGAGATG

GCCCAGCCAAGATGATTTTTGAAGGACCTAATAAATTAAGCCCTAGAATTGATGGACCTCCTACACCAGGTTCTCTTCGGTTTGATGGGTCACCAGGACA

AATGGGGGGAGGAGGCCCTATGAGATTTGAAGGACCACAAGGTCAGTTAGGAGGTGGGTGTCCTTTGAGATTTGAAGGTCCTCCAGGACCAGTAGGAACA

CCTCTGCGGTTTGAAGGGCCAATTGGTCAAGGAGGAGGAGGTGGTTTTCGATTTGAAGGTTCACCTAGTTTGAGGTTTGAGGGATCTACAGGTGGTTTAC

GATTTGAAGGACCAGGGGGTCAGCCCGTGGGTGGTCTCAGGTTTGAAGGACATCGTGGTCAACCTGTGGGTGGTCTCAGGTTTGAAGGACCTCATGGACA

GCCTGTGGGCAGTCTTAGATTTGATAATCCTCGAGGTCAGCCTGTAGGAGGACTTAGATTTGAAGGGGGTCATGGTCCATCAGGGGCTGCAATTAGGTTT

GATGGGCCTCATGGTCAGCCAGGTGGTGGTGGTGGTATCAGATTTGAGGGCCCTTTGCTACAGCAAGGAGTTGGAATGAGGTTTGAGGGTCCCCATGGTC

AGTCTGTAGCTGGTCTGAGATTTGAAGGACATAATCAACTAGGTGGGAACCTTAGGTTTGAGGGACCACATGGTCAACCAGGGGTTGGGATCAGGTTTGA

AGGACCTATAGTTCAACAAGGAGGTGGAATGAGGTTTGAAGGTCCTGTACCAGGAGGTGGCCTGAGAATTGAAGGGCCTCTGGGTCAAGGTGGTCCTAGA

TTTGAAGGTTGTCACTCTTTAAGGTTTGATGGACAGCCAGGTCAACCATCACTTTTGCCAAGATTTGATGGATTACATGGCCAGCCAGGTCCTAGATTTG

AAAGAACTGGTCAGCCAGGTCCACAGAGGTTTGATGGACCACCTGGACAGCAGGTTCAACCAAGATTTGATGGTGTACCTCAAAGATTTGATGGGCCACA

ACACCAGCAAGCATCAAGATTTGATATTCCTCTTGGTCTACAAGGAACTCGATTTGACAATCATCCTTCACAAAGGATTGAATCTTTCAATCATTCTGGC

CCATATAATGATCCACCTGGCAATACTTTTAATGTTCCATCTCAAGGATTACAGTTCCAAAGACACGAACAAATATTTGATACACCTCAAGGACCAAATT

TTAATGGACCACATGGCCCTGGAAATCAGAATTTCCCAAATCCCATTAACAGAGCTTCTGGACACTATTTTGATGAAAAGAATCTTCAGAGTTCTCAGTT

TGGAAACTTTGGCAATTTGCCTACACCAATATCAGTAGGAAATATTCAGGCATCTCAACAG GTTCTTACTGGTGTTGCTCAGCCAGTAGCGTTTGGCCA

AGGACAACAGTTCTTACCAGTTCATCCACAGAATCCTGGAGCTTTTATTCAAAATCCTTCAG GCGGTCTTCCCAAGGCATATCCTGATAATCATCTCAG

TCAGGTGGATGTAAACGAATTGTTTTCAAAACTGCTAAAAACAGGAATTCTCAAATTGTCACAGCCTGATTCAGCTACAGCAC AGGTAACCGAGGCTGT

TGCTCAGCCTCCCCCTGAGGAGGACGAGGATCAGAATGAAGATCAGGATGTTCCAGATCTTACCAATTTCACCATTGAAGAATTGAAGCA ACGTTATGA

CAGTGTTATAAACCGGCTGTACACTGGGATTCAATGTTACTCGTGTGGAATGAGGTTCACGACATCCCAGACAGATGTTTATGCAGATCACTTGGATTGG

CATTATCGGCAAAACAGAACCGAGAAAGATGTTAGCAGAAAAGTCACTCATAGACGTTGGTACTACAGTCTAACA GATTGGATAGAATTTGAAGAAATA

GCTGATCTGGAAGAACGTGCAAAAAGCCAGTTTTTTGAAAAGGTTCATGAAGAGGTTGTCCTTAAAACTCAGGAGGCTGCTAAAGAAAAGGAGTTCCAAA

GTGTACCTGCTGGACCAGCTGGAGCAGTTGAG - UNI19993 - AGTTGTGAAATCTGTCAAGAACAATTTGAACAGTACTGGGATGAAGAGGAGGAA

GAATGGCACTTAAAAAATGCTATTAGAGTAGACGGAAAG ATTTACCATCCATCATGTTATGAAGATTATCAAAAT - UNI7853 - ACATCTTCATT

TGATTGCACACCATCTCCCAGCAAGACACCAGTTGAAAACCCTTTGAACATTATGTTGAACATTGTCAAAAACGAATTGCAAGAACCCTGTGAAAGTCCC

AAAGTTAAGGAAGAACAAATTGATGCCCCACCAGCTTGTTCAGAAGAAAGTGTAGCAACACCCACTGAAATTAAAACAGAAAGTGATACAGTTGAGTCAG

TTTAAATAAAATGAGAAAAGTATGCTTTTCTTTTTAAACAAAAGCTGCTGTTGGATCTAGGTGAAGAATTTTTTTATGTATATATAGAAATATCTATATT

AATTGTCTAGCTGTGGCAGGGCCTTCAGCTATCATTTGGTTAATAAATACATTTTAGTATTTGCATTTCCTACTGCCTGCACAGTTTCAGGTGCTTGTTG

TGTGAAAGTTCTGTAGATGAGTGCAAATGTAACAAAATGAAATTGTATGTGTACAAATGTACAATTTTCACTTGTGAACTGTAAATTATAAATAAAAAAT

ATTTTTGCTATC
Translation
RHCRRHFVSVEKEAPAAAGSGRRFPVRLRRFFPEVPPGSSPIPPPWSACGEAAAAGDPGSEAEASEGRRGVERLQLRRRRTSEGGRGAMSEQTPAEAGAA

GAREDACRDYQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEAQTAK - UNI14426 - APSSEKLPVMYLMDSIVKNVGREYLTAFTKNLVA

TFICVFEK - UNI14426 - - UNI24750 - VDENTRKSLFKLRSTWDEIFPLKKLYALDVRVNSLDPAWPIKPLPPNVNTSSIHVNPKFLNKS P

DEPSTPGTVVSSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQL AVSLSVQQETANLGPGSVPSKLHVPQIPTMAVKTP

HQVPVQPDKSRAGPSLQMQDLKGTNRDPRLNRMSQHSSHGKEQSHRKEFVMNTINQSDIKTSKNVPSEKLNSSKQEKSKSGERITKKELDQLDSKSKSKS

KSPSPLKNKLSHTKDLKNQDSESMRLSDMSKRDPRLKKHLQDKAEGKDEDVKEKRKTAEKKEKDEHMKSSEHRVIGSRSKIINGIVQKQDMVTEELEKQG

TKPGRSSTRKRSRSRSPKSRSPIIHSPKRRDRRSPKRRQRSMSPNLAPKAGKMRQSGLKQSHMEEFPPPSREERNIKRSAKQDVRDPRRLKKMDEDRPQE

TAGQHSMKSGGDPKENIENWQSSKSAKRWKSGWEENKS SLQQGDEHSKPPHLRHRESWSSTKGILSPRAPKQQHRLSVDANLQIPKELTLASKRELLQK

 TSERLASGEITQDEFLVVVHQIRQLFQYQEG GVREEQRSPFNDRFPLKRPRYEDSDKPFVDGPASRFAGLDTNQRLTALAEDRPLFDGPGRPSVTRDG

PAKMIFEGPNKLSPRIDGPPTPGSLRFDGSPGQMGGGGPMRFEGPQGQLGGGCPLRFEGPPGPVGTPLRFEGPIGQGGGGGFRFEGSPSLRFEGSTGGLR

FEGPGGQPVGGLRFEGHRGQPVGGLRFEGPHGQPVGSLRFDNPRGQPVGGLRFEGGHGPSGAAIRFDGPHGQPGGGGGIRFEGPLLQQGVGMRFEGPHGQ

SVAGLRFEGHNQLGGNLRFEGPHGQPGVGIRFEGPIVQQGGGMRFEGPVPGGGLRIEGPLGQGGPRFEGCHSLRFDGQPGQPSLLPRFDGLHGQPGPRFE

RTGQPGPQRFDGPPGQQVQPRFDGVPQRFDGPQHQQASRFDIPLGLQGTRFDNHPSQRIESFNHSGPYNDPPGNTFNVPSQGLQFQRHEQIFDTPQGPNF

NGPHGPGNQNFPNPINRASGHYFDEKNLQSSQFGNFGNLPTPISVGNIQASQQ VLTGVAQPVAFGQGQQFLPVHPQNPGAFIQNPSG GGLPKAYPDNH

LSQVDVNELFSKLLKTGILKLSQPDSATAQ QVTEAVAQPPPEEDEDQNEDQDVPDLTNFTIEELKQ QRYDSVINRLYTGIQCYSCGMRFTTSQTDVYA

DHLDWHYRQNRTEKDVSRKVTHRRWYYSLT DWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVE - UNI19993 - SCE

ICQEQFEQYWDEEEEEWHLKNAIRVDGK IYHPSCYEDYQN - UNI7853 - TSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCESPKVKEEQIDA

PPACSEESVATPTEIKTESDTVESV

For any suggestions or comments, please send an email to unitrap@crg.es