Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041361 (Gcom1)
Chromosomal location
Chr 9: 71352154 - 71440167 (-)
Description
GRINL1A complex locus Gene [Source:MGI Symbol;Acc:MGI:2142908]
RefSeq_dna
NM_001033208 
RefSeq_peptide
NP_001028380.1 
MGI
MGI:2142908 
Uniprot/SWISSPROT
Q3UIJ9 
Uniprot/SPTREMBL
B2RT00 
Human Ortholog
ENSG00000137878 (GRINL1A)
Omim not available
UniTrap UNI28863
Vector Insertion
Chr 9: 71353037 - 71362875
Public Clones not available
Private Clones OST17700 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093823
Sequence
AGTGTCTGAGCCTCCCCCGCGTAGGGTGCGCCCCGCACGCTTATCCTGCCCCGGAGCAGCGCGGGCACCCAGCCCTTGCTCCACAGCCGCTGCGAGATGC

TGCGCTCCACGTCCACTGTCACCCTGTTCTCAGGTGGCGGCGCCAAGTCGCCTGGAACGCCCAGTAGAAGG GCAAATGTCTGCAGACTGCGGCTGACTG

TGCCCCCTGAGAATCCAGTGCCACAGCAAACAGAAAAGAAGATCGAAAGGAAAGATCAG CCTCCAGAACTAAGCAATGGAGAATCTACCAAGAGGCTCC

CTCAGGGTGTTGTCTATGGTGTGGTGCGAAGATCAGATCCCAACCAGCAGAAGGAAATGGTCGTGTATGGCTGGTCCACCAATCAGCTGAAAGAAGAGAT

GAATTACATCAAAGAC GTGAGGGCCACACTGGAGAAAGTGAGGAAGCGGATGTATGGAGACTATGATGAGATGAGACAGAAGATCCGACAGCTCACCCA

GGACCTGTCG GTGTCCCATGCTCAGCAGGACTATCTAGACAGTCACATCCAAGCCCAGGCATCGGCCCTGGATAGCTTCAATGCCATGAATGCGGCATT

GGCATCAGACTCTGTTGGCTTACAG AAAACCCTTGTGGACGTGACTTTGGAAAATAGCCATATCAAGGATCAAATCCGACATCTGCAACAGACCTATGA

AGCATCCATGGACAAGCTGCGGGAGAAGCAGAGGCAGTTAGAGGCTGCTCAGATGGAAAACCAGCTCCTAAAGATGAGG GTGGAGTCATCGCAAGAAGC

CAATGCTGAGGTGATGCGGGAGATGACGAGAAAGCTGTACAGCCAGTATGAGGAGAAACTGCAGGAGGCACAGCGCAAGCACAGTGCGGAGAAGGAGGTG

CTCCTG GAAGAAACCAATAGCTTTCTGAAGGCCATCGAAGAGGCCAATAAGAAGATGGAGGCAGCTGAGCTCAGCCTGGAGGAGAAAGACCAGAAGATC

GGGGAACTGGACAGGCTGATTGAACGCATGGAGAAG GAACGGCATCAGCTCCAGCTCCAGCTCCTTGAGCATGAGACAGAAATGTCAGGGGAGATGGCA

GATTCTGACAAGAACAG GTACCAGCAGCTGGAGGAGGCGTCGGCCAGCCTCCGGGAGCGGATCAGACACCTGGATGACATGGTGCACTGCCAGCAGAAG

AAAGTCAAGCAGATGGTTGAGGAG ATTGAGTCATTAAAGAAAAAAGTGCAACAGAAGCAGCTCCTGATACTGCAGCTTTTAGAAAAAATCTCTTTCCTG

GAAGGAGAG AATAATGAACTACAAAGCAGGTTGGACTATTTGACAGAAACCCAGCCCAAGACTGAAGTGGAAACAAGAGAAATTGGAGTGGGGTGTGAT

CTTCTTCCCAG - UNI28863 - CCCAACAGGCAGGACTCGTGAAATCACAATGCCTTCCAGGAGTTACACCCCGTACACGAGAGTCCTGGAGTTATC

CTCAAAGAAAACGCTGACTTAGGCACTCAGAGACATACGCCTCTTGCGGATGCTGCAAAGCCCTGGAAGCCTGTGACTTAAAAGTCCGGAGAGGGTGGCA

ATTGCTTCCTCGAAGACATGGTGTCACCTTGAATAGGAATCTCAGGCAATCGAGACAGAGAGAGCCAGCAAGGGCTGGTACCTGAGGTCATATTTCAGAC

ACCCACCTGACCCTGCCACTCACAGCCGTCGTTTGTTTTCCATGGATGCAGAAGTCCAGGTTTCACCATCTATTTTCTGTTTTACTCGATTTTGGTTTGG

AGGGAAAAGGGCATTAGTTTAAAATGTCGTTTTTGTTACAGCACAAAGGTTTTGTTTACCCGTCAAGTATTAGCAGCAGTATTTCTCCCACACGGAGAAG

CCTGTGCACAAGTAGCATGGGCACCTGGAAAACTTGAACCTGGAAGGAAAGATTCCCAGCATGCAGTGCTCTCTCCTCCAGGGAGGAGAATGTGTGCTGG

GCTATGGGAGCCATGTTCAGAGATTTGTGTGTGTGTGCCAGAGTAGCTGCATTCTGATTCACTAATCCCTCATTTTAATGTGTGCCTTATGCCTTGAATG

GACCAGCTGAGATCACTATATTTATTCAAGCTGTGATTGTTTTCTTTCTCACTCAAAAAAGAATTTTGTATGTTGTGGCATTTAATCATTTCATGTTCAG

TAACAAATGATATTTTTGTTAAATGGACGAGGAGTCCATTCACGCACGCTCTACTTTGATATTAAAACCCACATAACATATATTTAATAAATTCTATCTA

TTTTGTTC
Translation
MLRSTSTVTLFSGGGAKSPGTPSRR ANVCRLRLTVPPENPVPQQTEKKIERKDQ PPELSNGESTKRLPQGVVYGVVRRSDPNQQKEMVVYGWSTNQLK

EEMNYIKD VRATLEKVRKRMYGDYDEMRQKIRQLTQDLS VSHAQQDYLDSHIQAQASALDSFNAMNAALASDSVGLQ KTLVDVTLENSHIKDQIRHL

QQTYEASMDKLREKQRQLEAAQMENQLLKMR VESSQEANAEVMREMTRKLYSQYEEKLQEAQRKHSAEKEVLL EETNSFLKAIEEANKKMEAAELSLE

EKDQKIGELDRLIERMEK ERHQLQLQLLEHETEMSGEMADSDKNR RYQQLEEASASLRERIRHLDDMVHCQQKKVKQMVEE IESLKKKVQQKQLLIL

QLLEKISFLEGE NNELQSRLDYLTETQPKTEVETREIGVGCDLLPS - UNI28863 - SPTGRTREITMPSRSYTPYTRVLELSSKKTLT

For any suggestions or comments, please send an email to unitrap@crg.es