Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041408 (Wapal)
Chromosomal location
Chr 14: 35487114 - 35559403 (+)
Description
wings apart-like homolog (Drosophila) Gene [Source:MGI (curated);Acc:Wapal-001]
RefSeq_dna
NM_001004436 
RefSeq_peptide
NP_001004436.2 
UniGene
Mm.27957 
MGI
MGI:2675859 
Uniprot/SWISSPROT
Q65Z40 
Human Ortholog
ENSG00000062650 (WAPAL)
Omim not available
UniTrap UNI13210
Vector Insertion
Chr 14: 35487547 - 35490139
Public Clones (sanger) CMHD-GT_347G1-3 (cmhd) IST13235C5 (tigm)
Private Clones OST369926 (lexicon) OST213581 (lexicon) OST178393 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5570
Vector Insertion
Chr 14: 35490139 - 35490661
Public Clones TEA135 (baygenomics) RRC078 (baygenomics) YTA258 (baygenomics) XC324 (baygenomics)
A060F03 (ggtc) A060E04 (ggtc)
Private Clones OST134571 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36419
Vector Insertion
Chr 14: 35490661 - 35504867
Public Clones IST11625F4 (tigm) IST13973D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4447
Vector Insertion
Chr 14: 35505921 - 35507522
Public Clones AC0195 (sanger) (sanger) IST10033F10 (tigm) IST13096A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32011
Vector Insertion
Chr 14: 35507633 - 35508172
Public Clones IST13044C5 (tigm) IST13014F4 (tigm) IST13056E10 (tigm) IST14198A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4019
Vector Insertion
Chr 14: 35508172 - 35508292
Public Clones AQ0986 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18374
Vector Insertion
Chr 14: 35508172 - 35508292
Public Clones not available
Private Clones OST424699 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4014
Vector Insertion
Chr 14: 35508292 - 35535449
Public Clones (sanger) AQ1029 (sanger) RRH204 (baygenomics) E067H05 (ggtc) IST14720B4 (tigm)
IST15068B12 (tigm) IST14345A10 (tigm) IST12691C7 (tigm) IST13396A5 (tigm)
IST10434C4 (tigm) IST14624G9 (tigm) IST14331A1 (tigm) IST14999G1 (tigm)
IST14134D5 (tigm) IST13121E9 (tigm) IST12995F9 (tigm) IST10740E5 (tigm)
IST14036F6 (tigm) IST12425H12 (tigm) IST14677C12 (tigm) IST13707H3 (tigm)
IST14490E12 (tigm) IST14635D2 (tigm) IST11089B8 (tigm) IST14518D10 (tigm)
IST12900C10 (tigm) IST12445A12 (tigm) IST12001C10 (tigm) IST11845H6 (tigm)
IST12022H4 (tigm) IST10923F5 (tigm) IST12616A1 (tigm) IST10609H5 (tigm)
IST14796C6 (tigm) IST12339A4 (tigm) IST14555G1 (tigm) IST11439G10 (tigm)
IST14840E5 (tigm)
Private Clones OST430756 (lexicon) OST36725 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25664
Vector Insertion
Chr 14: 35537891 - 35538045
Public Clones not available
Private Clones OST171105 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25375
Vector Insertion
Chr 14: 35538313 - 35538451
Public Clones not available
Private Clones OST186263 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5598
Vector Insertion
Chr 14: 35543847 - 35544694
Public Clones YTA302 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10450
Vector Insertion
Chr 14: 35546994 - 35549855
Public Clones D058H09 (ggtc) IST11795B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111895
Sequence
GATGTGGAGAGACCATGTGGATAAACCAGGAGGATTCTCCATTGAGGTCTCTTGAGAGAGCAGCCATGAGGACAAACATGGACTAGAGTGAGCCAAGGCA

AGACTCAGAT - UNI4019 - - UNI18374 - - UNI32011 - AAAACTTGGATTTTACAGAGGACTTGCCTGGTGTGCCTGAGAGTGTGAAGA

AGCCCATAAGTAAACAAGGAGATAAATCCAAGGAAAATACCAGAAAGATTTTTAGTGGCCCCAAACGG - UNI4014 - - UNI4019 - - UNI18

374 - TCACCTACAAAAGCTGTATATAATGCCAGGCATTGGAACCATCCAGACTCGGAAGAATTGCCTGGACCACCAATAGCAAAACCTCAGCGTGTCA

CA - UNI25664 - GTGAGGCTGTCTTCAAAGGAACCAAATCAAAAAGATGATGGAGTTTTTAAGGCTCCTGCACCACCACTCAAAGTGATAAAAACT

GTGACAATACCTACTCAGCCCTACCAAGAAATAGTTACTGCACTGAAATGCAGAAAAGAAGACAAAGAA - UNI25375 - - UNI25664 - TTAT

ATACTGTTGTTCAGCACGTGAAACACTTCAATGATGTGGTGGAATTTGGTGAAAATCAAGAGTTCACTGATGACATTGAATACTTGTTAAGTGGCTTAAA

GAGTACTCAGCCTCTAAACACACGTTGCCTTAG - UNI25375 - TGTTATCAGCTTAGCTACTAAATGTGCCATGCCCAGTTTTCGGATGCATCTGA

GGGCACATGGGATGGTTGCAATGGTCTTTAAAACTTTGGATGATTCCCAGCATCATCAG AATCTGTCCCTCTGTACAGCTGCTCTCATGTACATATTGA

GTAGAGACCGTTTGAACATGGATCTTGATAGGGCCAGCCTAGATCTCATGATTCGGCTTTTGGAGTTGGAACAAGATGCCTCTTCAGCTAAGCTACTGAA

TGAAAAAGACATGAACAAGATCAAAGAAAAGATCCGAAGACTCTGTGAAACTGTGCACAACAAGCATCTTGATCTAGAAAACATAACG ACTGGTCATTT

AGCTATGGAGACATTGCTGTCCCTCACTTCCAAACGAGCAGGAGATTGGTTTAAAGAAGAGCTCCGACTTCTGGGTGGTCTGGATCATATTGTAGATAAA

G - UNI5598 - TAAAAGAGTGTGTGGATCATTTAAGTAGAGATGATGAGGACGAAGAGAAACTAGTAGCCTCATTATGGGGAGCAGAGAGATGTTTA

CGAGTTTTAGAGAGT GTAACAGTGCATAATCCAGAGAATCAAAGCTACTTGATAGCCTATAAAGATTCACAACTCATTATTTCATCAGCTAA - UNI1

0450 - AGCATTACAGCATTGTGAAGACCTGATTCAGCAGTACAACCGTGCTGAGAACAGCATCTGTGTAGCAGACAGTAACCCTCTGCCTTACCAGAA

TGTAACTAACCATGTGGGCAAAGCAGTGGAGGACTGCATGAGGGCTATAATTGGAGTATTGCTCAATTTAACTAATGATAATG AGTGGGGCAGCACAAA

GACAGGAGAACAAGAAGGACTCATAGGCACAGCGATGAACTGTGTTCTTCAGGTTCCAAAGTACCTACCTCAGGAGCAGAGATTTGATATTCGAGTGCTG

 GGATTGGGTCTACTCATAAACCTGGTGGAGTATAGTGCCCGGAATCGACACTGCCTTGTCAACATGCAAACATCCTGTTCCTTTGATTCCTCCTTCTCT

AGTGGAGAAGGCGATCATAGTTTAAGGCTAGCCGGACAAGTTCATGCTGTTCAAGCTTTAGTGCAG CTATTTCTCGAACGAGAGAGAGCAGCACAATTG

GCAGAAAGTAAAACAGATGAATTGATTAAAGATGCTCCTACCACTCAGCATGATAAGAGTGGAGAGTGGCAAGAAACAAGTGGAGAAATACAGTGGGTAT

CAACTGAAAAGACTGATGGTGCAGAGGAGAAGCAGAAGAAGGAGGAGGAGGATGAAGAACTTGACCTCAATAAAG CCCTTCAGCATGCTGGCAAACACA

TGGAGGATTGCATCGTAGCCTCCTACACAGCCCTGCTTCTTGGGTGTCTCTGCCAGGAAAGTCCA ATCAATGTAACTACAGTAAGGGAATATCTTCCAG

AAGGAGATTTCTCCATAATGACAGAGATGCTTAAAAAGTTCTTAAGCTTCATGAATCTTACG TGTGCTGTTGGAACAACAGGCCAGAAGTCTATCTCTA

GAGTGATTGAATATTTGGAACATTGCTAGCTGCTTTACCTTTGCTTCAGGTGCTTGGTAATGCTGAAGCTATCCTTAGACAAAGAAAAGACATGAAAGAA

GTCCTTGAAGATATACCAAGAACATTCATCAGTATCATTCATTCGTGTTTGGATTTTTATGATCACCCGATTTCTTCATCATGCATTCTGCGTTTGCTAA

ATGACAGTTACTACATCAATCTGCAGCTATCAAAAATGAGGGAAAAGGTTCAGGCTGTTAACAATCCCATGCAGTATTTAAATACACTTACTTGGCAGAG

TCTATACCTGCCCCTGTTTCCTTGCTGTATTTCAGGCAAGGTTTAAAGAGGGCAATTTGTGCTGCTGTTAGTGCAACTGCTGTGTATGTTGAGCCACTGT

TGTCATGCCAGTCAGGTGCAAAGGCAGCTTAGCTACTGAGGTATTGAATGTTCTGAGGACATTCTAGACAACAGCTTAGATCCTTTTTCAGGCTCATTTG

CTTTTGCTTTTTGTTGAATGATTCCAATCGTAAATAAAGCTTTTAATAATTTTGTG
Translation
 - UNI4019 - - UNI18374 - - UNI32011 -  - UNI4014 - - UNI4019 - - UNI18374 -  - UNI25664 -  - UNI253

75 - - UNI25664 -  - UNI25375 - MPSFRMHLRAHGMVAMVFKTLDDSQHHQ NLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQD

ASSAKLLNEKDMNKIKEKIRRLCETVHNKHLDLENIT TGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKV - UNI5598 - VKECVDHLSRD

DEDEEKLVASLWGAERCLRVLES VTVHNPENQSYLIAYKDSQLIISSAK - UNI10450 - KALQHCEDLIQQYNRAENSICVADSNPLPYQNVTNH

VGKAVEDCMRAIIGVLLNLTNDNE EWGSTKTGEQEGLIGTAMNCVLQVPKYLPQEQRFDIRVL GLGLLINLVEYSARNRHCLVNMQTSCSFDSSFSSG

EGDHSLRLAGQVHAVQALVQ LFLERERAAQLAESKTDELIKDAPTTQHDKSGEWQETSGEIQWVSTEKTDGAEEKQKKEEEDEELDLNKA ALQHAGKH

MEDCIVASYTALLLGCLCQESP INVTTVREYLPEGDFSIMTEMLKKFLSFMNLT CAVGTTGQKSISRVIEYLEHC
Transcript ENSMUST00000090027
Sequence
GGCGTTGAGATGGTTCAGGGCCCTGTTCAAACTCCAGCGCTGACCATTCACCGGCGGAGGCGGCGGCGCAGAAGGCGGCGGCGGCCCAGCGGGGGCAC C

ACCCGCCAGGCGCCGAGG - UNI5570 - - UNI13210 - GGAATATGAAACAGGTGTCAAAATGACATCCAGATTTGGAAAAACTTACAGTAGGA

AAGGAGGAAATGGCAGTTCAAAATTTGATGAAGTTTTTTCCAACAAACGGACTACTCTTAGTACAAAATGGGGTGAGACCACATTTATGGCTAAATTAGG

GCAGAAGAGGCCCAATTTCAAACCAGATATTCAAGAAATTCCGAAGAAACCTAAAGTAGAAGAAGAAGATACTGGAGATCCCTTTGGTTTTGATAGTGAT

GATGAGTCTCTACCTGTTTCTTCAAAAAATTTAGCCCAGGGTAAGGGTTCATCTTACTCAGAATCTAGTGAGGCTGCTCAGCTGGAAGAAGTCACTTCTG

TATTTGAAGCTAATAGCAAATGTAGTCATGTGGTGGGTGAAGACAGTTTTGCTTCCGACAGATGCTTACTTGTGGAGGATACTTTAATTGGGAAAGAGAA

GAGCATAAGTAGAATTCCAGAAGACAACGCAAACAAAAGTAGTTGCACTAAGTTGCTAACTTCAG - UNI5570 - - UNI36419 - ATAAAGTGG

AGAATTTTAGTGAAGAACATGAAAAAAATAGTCACCACTTTCACAAAAATGCTGAAGATAGTACTAAGAAACCCAATGCAGAAACCGCAGTGGCTTCTGA

ATATAAAGCTGATGAAACTAAAGAAACAAATGATACTTGGAACTCCCAGTCTGGAAAAAGAACAGAGTCTCCATCTGAAAGTTGTCCAGTCAAAGGATCT

GTAAGAACTGGTTTATATGAATGGGATAATGATTTTGAAGATATCAGGTCAGAAGACTGTATTTTAAGTTTGGATAATGAGTCTCTTTTGGAGATGAAAG

ACGAGGATTTAAAAAATCGGATTGGAGGATTGGAAAATCTAAATGAAACCTTTGAAGAAGATATCATACAAAGTGTTCTTAGGCCAAGCAACTGTAGGAC

GTACTGTAGGGCCAATAAAGCGAGATCCTCACAGGGAGCATCAAATTTTGATAAGCTAATGGATGGCACCAGTCAGTCCTTAGCCAAAGCAAACAGTGAA

TCAAGTAAAGATGGCCTGAATCAGGCAAAGAAAGGTAGTGCAAGTTGTGGGACCAGTTTTCGAGGAACAGTTGGACGGACTAGAGATTACACTGTTTTAC

ATCCATCTTGCTTGTCAGTGTGTAATGTTACCATCCAGGATACTATGGAACGGAGTATGGATGAGTTCACCGCATCCACTCCTGCAGATTTAGGAGAGGC

TGGCCGGCTCAGAAAAAAGGCAGATATTGCAACCTCCAAGACCACTACTAGATTTCGACCTAGTAATACTAAATCCAAAAAGGATGTTAAACTTGAATTT

TTTGGTTTTGAAGATCATGATGAGACAGGAGGTGATGAAGGGGGTTCTGGAAGTTCTAATTACAAAATTAAATATTTTGGCTTTGACGATCTCAGCGAAA

GTGAAGATGATGATGATGACGACTGTCAAGTGGAAAGAAAGAAAGACAAAAAAAGAACTAAAACAGCTCCATCACCTTCCCAGCAGCCTCCTCCTGAAAG

CAGCGACAATTCCCAGGATAGTCAGTCTAGTACTAATAATGCAG - UNI4019 - - UNI4447 - - UNI18374 - - UNI32011 - AGGAC

TTGCCTGGTGTGCCTGAGAGTGTGAAGAAGCCCATAAGTAAACAAGGAGATAAATCCAAGGAAAATACCAGAAAGATTTTTAGTGGCCCCAAACGG - U

NI4014 - - UNI4019 - - UNI18374 - TCACCTACAAAAGCTGTATATAATGCCAGGCATTGGAACCATCCAGACTCGGAAGAATTGCCTGGA

CCACCAATAGCAAAACCTCAGCGTGTCACA - UNI25664 - GTGAGGCTGTCTTCAAAGGAACCAAATCAAAAAGATGATGGAGTTTTTAAGGCTCC

TGCACCACCACTCAAAGTGATAAAAACTGTGACAATACCTACTCAGCCCTACCAAGAAATAGTTACTGCACTGAAATGCAGAAAAGAAGACAAAGAA - 

UNI25375 - - UNI25664 - TTATATACTGTTGTTCAGCACGTGAAACACTTCAATGATGTGGTGGAATTTGGTGAAAATCAAGAGTTCACTGATG

ACATTGAATACTTGTTAAGTGGCTTAAAGAGTACTCAGCCTCTAAACACACGTTGCCTTAG - UNI25375 - TGTTATCAGCTTAGCTACTAAATGT

GCCATGCCCAGTTTTCGGATGCATCTGAGGGCACATGGGATGGTTGCAATGGTCTTTAAAACTTTGGATGATTCCCAGCATCATCAG AATCTGTCCCTC

TGTACAGCTGCTCTCATGTACATATTGAGTAGAGACCGTTTGAACATGGATCTTGATAGGGCCAGCCTAGATCTCATGATTCGGCTTTTGGAGTTGGAAC

AAGATGCCTCTTCAGCTAAGCTACTGAATGAAAAAGACATGAACAAGATCAAAGAAAAGATCCGAAGACTCTGTGAAACTGTGCACAACAAGCATCTTGA

TCTAGAAAACATAACG ACTGGTCATTTAGCTATGGAGACATTGCTGTCCCTCACTTCCAAACGAGCAGGAGATTGGTTTAAAGAAGAGCTCCGACTTCT

GGGTGGTCTGGATCATATTGTAGATAAAG - UNI5598 - TAAAAGAGTGTGTGGATCATTTAAGTAGAGATGATGAGGACGAAGAGAAACTAGTAGC

CTCATTATGGGGAGCAGAGAGATGTTTACGAGTTTTAGAGAGT GTAACAGTGCATAATCCAGAGAATCAAAGCTACTTGATAGCCTATAAAGATTCACA

ACTCATTATTTCATCAGCTAA - UNI10450 - AGCATTACAGCATTGTGAAGACCTGATTCAGCAGTACAACCGTGCTGAGAACAGCATCTGTGTAG

CAGACAGTAACCCTCTGCCTTACCAGAATGTAACTAACCATGTGGGCAAAGCAGTGGAGGACTGCATGAGGGCTATAATTGGAGTATTGCTCAATTTAAC

TAATGATAATG AGTGGGGCAGCACAAAGACAGGAGAACAAGAAGGACTCATAGGCACAGCGATGAACTGTGTTCTTCAGGTTCCAAAGTACCTACCTCA

GGAGCAGAGATTTGATATTCGAGTGCTG GGATTGGGTCTACTCATAAACCTGGTGGAGTATAGTGCCCGGAATCGACACTGCCTTGTCAACATGCAAAC

ATCCTGTTCCTTTGATTCCTCCTTCTCTAGTGGAGAAGGCGATCATAGTTTAAGGCTAGCCGGACAAGTTCATGCTGTTCAAGCTTTAGTGCAG CTATT

TCTCGAACGAGAGAGAGCAGCACAATTGGCAGAAAGTAAAACAGATGAATTGATTAAAGATGCTCCTACCACTCAGCATGATAAGAGTGGAGAGTGGCAA

GAAACAAGTGGAGAAATACAGTGGGTATCAACTGAAAAGACTGATGGTGCAGAGGAGAAGCAGAAGAAGGAGGAGGAGGATGAAGAACTTGACCTCAATA

AAG CCCTTCAGCATGCTGGCAAACACATGGAGGATTGCATCGTAGCCTCCTACACAGCCCTGCTTCTTGGGTGTCTCTGCCAGGAAAGTCCA ATCAAT

GTAACTACAGTAAGGGAATATCTTCCAGAAGGAGATTTCTCCATAATGACAGAGATGCTTAAAAAGTTCTTAAGCTTCATGAATCTTACG TGTGCTGTT

GGAACAACAGGCCAGAAGTCTATCTCTAGAGTGATTGAATATTTGGAACATTGCTAGCTGCTTTACCTTTGCTTCAGGTGCTTGGTAATGCTGAAGCTAT

CCTTAGACAAAGAAAAGACATGAAAGAAGTCCTTGAAGATATACCAAGAACATTCATCAGTATCATTCATTCGTGTTTGGATTTTTATGATCACCCGATT

TCTTCATCATGCATTCTGCGTTTG
Translation
  - UNI5570 - - UNI13210 - MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEEDTGDPF

GFDSDDESLPVSSKNLAQGKGSSYSESSEAAQLEEVTSVFEANSKCSHVVGEDSFASDRCLLVEDTLIGKEKSISRIPEDNANKSSCTKLLTSD - UNI

5570 - - UNI36419 - DKVENFSEEHEKNSHHFHKNAEDSTKKPNAETAVASEYKADETKETNDTWNSQSGKRTESPSESCPVKGSVRTGLYEWDN

DFEDIRSEDCILSLDNESLLEMKDEDLKNRIGGLENLNETFEEDIIQSVLRPSNCRTYCRANKARSSQGASNFDKLMDGTSQSLAKANSESSKDGLNQAK

KGSASCGTSFRGTVGRTRDYTVLHPSCLSVCNVTIQDTMERSMDEFTASTPADLGEAGRLRKKADIATSKTTTRFRPSNTKSKKDVKLEFFGFEDHDETG

GDEGGSGSSNYKIKYFGFDDLSESEDDDDDDCQVERKKDKKRTKTAPSPSQQPPPESSDNSQDSQSSTNNAE - UNI4019 - - UNI4447 - - U

NI18374 - - UNI32011 - EDLPGVPESVKKPISKQGDKSKENTRKIFSGPKR - UNI4014 - - UNI4019 - - UNI18374 - SPTKA

VYNARHWNHPDSEELPGPPIAKPQRVT - UNI25664 - VRLSSKEPNQKDDGVFKAPAPPLKVIKTVTIPTQPYQEIVTALKCRKEDKE - UNI25

375 - - UNI25664 - LYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLS - UNI25375 - SVISLATKCAMPSFRMHLRAH

GMVAMVFKTLDDSQHHQ NLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKHLDLENIT TGHLA

METLLSLTSKRAGDWFKEELRLLGGLDHIVDKV - UNI5598 - VKECVDHLSRDDEDEEKLVASLWGAERCLRVLES VTVHNPENQSYLIAYKDSQ

LIISSAK - UNI10450 - KALQHCEDLIQQYNRAENSICVADSNPLPYQNVTNHVGKAVEDCMRAIIGVLLNLTNDNE EWGSTKTGEQEGLIGTAM

NCVLQVPKYLPQEQRFDIRVL GLGLLINLVEYSARNRHCLVNMQTSCSFDSSFSSGEGDHSLRLAGQVHAVQALVQ LFLERERAAQLAESKTDELIKD

APTTQHDKSGEWQETSGEIQWVSTEKTDGAEEKQKKEEEDEELDLNKA ALQHAGKHMEDCIVASYTALLLGCLCQESP INVTTVREYLPEGDFSIMTE

MLKKFLSFMNLT CAVGTTGQKSISRVIEYLEHC
Transcript ENSMUST00000048263
Sequence
GTTGGAGGAAGGAGGTGGGGGGCCGGGAGCGCAAATGGCGTTGAGATGGTTCAGGGCCCTGTTCAAACTCCAGCGCTGACCATTCACCGGCGGAGGCGGC

GGCGCAGAAGGCGGCGGCGGCCCAGCGGGGGCACGTAGCGGGCTCGGCACCGGCGGCGGCCGCCAGGGAGGCCTAGGCCCTGTCCGGCCGGCGCGCCTGA

GGTGGGGAGGGAAGTTGCGGGGCCGCCGCTCACCCCCCACCCCCCCTGTCGCCCGAGCTTCCTATTTACCGAAGCGGAGCCGCGGACTGTGACGGCAGCA

GAGCCCCTCGCCCCTCTCGGTGGCACCGGTCGGCACTGGTCTCTCGCGCGGGGCTCCCGCGCCCGCCCGCGGGCCGTTGGGAGCCGGAGAGGCGGAGGCG

GCCCGAGGCCAAAGCACCCGCCAGGCGCCGAGG - UNI5570 - - UNI13210 - GGAATATGAAACAGGTGTCAAAATGACATCCAGATTTGGAA

AAACTTACAGTAGGAAAGGAGGAAATGGCAGTTCAAAATTTGATGAAGTTTTTTCCAACAAACGGACTACTCTTAGTACAAAATGGGGTGAGACCACATT

TATGGCTAAATTAGGGCAGAAGAGGCCCAATTTCAAACCAGATATTCAAGAAATTCCGAAGAAACCTAAAGTAGAAGAAGAAGATACTGGAGATCCCTTT

GGTTTTGATAGTGATGATGAGTCTCTACCTGTTTCTTCAAAAAATTTAGCCCAGGGTAAGGGTTCATCTTACTCAGAATCTAGTGAGGCTGCTCAGCTGG

AAGAAGTCACTTCTGTATTTGAAGCTAATAGCAAATGTAGTCATGTGGTGGGTGAAGACAGTTTTGCTTCCGACAGATGCTTACTTGTGGAGGATACTTT

AATTGGGAAAGAGAAGAGCATAAGTAGAATTCCAGAAGACAACGCAAACAAAAGTAGTTGCACTAAGTTGCTAACTTCAG - UNI5570 - - UNI36

419 - ATAAAGTGGAGAATTTTAGTGAAGAACATGAAAAAAATAGTCACCACTTTCACAAAAATGCTGAAGATAGTACTAAGAAACCCAATGCAGAAAC

CGCAGTGGCTTCTGAATATAAAGCTGATGAAACTAAAGAAACAAATGATACTTGGAACTCCCAGTCTGGAAAAAGAACAGAGTCTCCATCTGAAAGTTGT

CCAGTCAAAGGATCTGTAAGAACTGGTTTATATGAATGGGATAATGATTTTGAAGATATCAGGTCAGAAGACTGTATTTTAAGTTTGGATAATGAGTCTC

TTTTGGAGATGAAAGACGAGGATTTAAAAAATCGGATTGGAGGATTGGAAAATCTAAATGAAACCTTTGAAGAAGATATCATACAAAGTGTTCTTAGGCC

AAGCAACTGTAGGACGTACTGTAGGGCCAATAAAGCGAGATCCTCACAGGGAGCATCAAATTTTGATAAGCTAATGGATGGCACCAGTCAGTCCTTAGCC

AAAGCAAACAGTGAATCAAGTAAAGATGGCCTGAATCAGGCAAAGAAAGGTAGTGCAAGTTGTGGGACCAGTTTTCGAGGAACAGTTGGACGGACTAGAG

ATTACACTGTTTTACATCCATCTTGCTTGTCAGTGTGTAATGTTACCATCCAGGATACTATGGAACGGAGTATGGATGAGTTCACCGCATCCACTCCTGC

AGATTTAGGAGAGGCTGGCCGGCTCAGAAAAAAGGCAGATATTGCAACCTCCAAGACCACTACTAGATTTCGACCTAGTAATACTAAATCCAAAAAGGAT

GTTAAACTTGAATTTTTTGGTTTTGAAGATCATGATGAGACAGGAGGTGATGAAGGGGGTTCTGGAAGTTCTAATTACAAAATTAAATATTTTGGCTTTG

ACGATCTCAGCGAAAGTGAAGATGATGATGATGACGACTGTCAAGTGGAAAGAAAGAAAGACAAAAAAAGAACTAAAACAGCTCCATCACCTTCCCAGCA

GCCTCCTCCTGAAAGCAGCGACAATTCCCAGGATAGTCAGTCTAGTACTAATAATGCAG - UNI4019 - - UNI4447 - - UNI18374 - - U

NI32011 - AAAACTTGGATTTTACAGAGGACTTGCCTGGTGTGCCTGAGAGTGTGAAGAAGCCCATAAGTAAACAAGGAGATAAATCCAAGGAAAATA

CCAGAAAGATTTTTAGTGGCCCCAAACGG - UNI4014 - - UNI4019 - - UNI18374 - TCACCTACAAAAGCTGTATATAATGCCAGGCAT

TGGAACCATCCAGACTCGGAAGAATTGCCTGGACCACCAATAGCAAAACCTCAGCGTGTCACA - UNI25664 - GTGAGGCTGTCTTCAAAGGAACC

AAATCAAAAAGATGATGGAGTTTTTAAGGCTCCTGCACCACCACTCAAAGTGATAAAAACTGTGACAATACCTACTCAGCCCTACCAAGAAATAGTTACT

GCACTGAAATGCAGAAAAGAAGACAAAGAA - UNI25375 - - UNI25664 - TTATATACTGTTGTTCAGCACGTGAAACACTTCAATGATGTGG

TGGAATTTGGTGAAAATCAAGAGTTCACTGATGACATTGAATACTTGTTAAGTGGCTTAAAGAGTACTCAGCCTCTAAACACACGTTGCCTTAG - UNI

25375 - TGTTATCAGCTTAGCTACTAAATGTGCCATGCCCAGTTTTCGGATGCATCTGAGGGCACATGGGATGGTTGCAATGGTCTTTAAAACTTTGG

ATGATTCCCAGCATCATCAG AATCTGTCCCTCTGTACAGCTGCTCTCATGTACATATTGAGTAGAGACCGTTTGAACATGGATCTTGATAGGGCCAGCC

TAGATCTCATGATTCGGCTTTTGGAGTTGGAACAAGATGCCTCTTCAGCTAAGCTACTGAATGAAAAAGACATGAACAAGATCAAAGAAAAGATCCGAAG

ACTCTGTGAAACTGTGCACAACAAGCATCTTGATCTAGAAAACATAACG ACTGGTCATTTAGCTATGGAGACATTGCTGTCCCTCACTTCCAAACGAGC

AGGAGATTGGTTTAAAGAAGAGCTCCGACTTCTGGGTGGTCTGGATCATATTGTAGATAAAG - UNI5598 - TAAAAGAGTGTGTGGATCATTTAAG

TAGAGATGATGAGGACGAAGAGAAACTAGTAGCCTCATTATGGGGAGCAGAGAGATGTTTACGAGTTTTAGAGAGT GTAACAGTGCATAATCCAGAGAA

TCAAAGCTACTTGATAGCCTATAAAGATTCACAACTCATTATTTCATCAGCTAA - UNI10450 - AGCATTACAGCATTGTGAAGACCTGATTCAGC

AGTACAACCGTGCTGAGAACAGCATCTGTGTAGCAGACAGTAACCCTCTGCCTTACCAGAATGTAACTAACCATGTGGGCAAAGCAGTGGAGGACTGCAT

GAGGGCTATAATTGGAGTATTGCTCAATTTAACTAATGATAATG AGTGGGGCAGCACAAAGACAGGAGAACAAGAAGGACTCATAGGCACAGCGATGAA

CTGTGTTCTTCAGGTTCCAAAGTACCTACCTCAGGAGCAGAGATTTGATATTCGAGTGCTG GGATTGGGTCTACTCATAAACCTGGTGGAGTATAGTGC

CCGGAATCGACACTGCCTTGTCAACATGCAAACATCCTGTTCCTTTGATTCCTCCTTCTCTAGTGGAGAAGGCGATCATAGTTTAAGGCTAGCCGGACAA

GTTCATGCTGTTCAAGCTTTAGTGCAG CTATTTCTCGAACGAGAGAGAGCAGCACAATTGGCAGAAAGTAAAACAGATGAATTGATTAAAGATGCTCCT

ACCACTCAGCATGATAAGAGTGGAGAGTGGCAAGAAACAAGTGGAGAAATACAGTGGGTATCAACTGAAAAGACTGATGGTGCAGAGGAGAAGCAGAAGA

AGGAGGAGGAGGATGAAGAACTTGACCTCAATAAAG CCCTTCAGCATGCTGGCAAACACATGGAGGATTGCATCGTAGCCTCCTACACAGCCCTGCTTC

TTGGGTGTCTCTGCCAGGAAAGTCCA ATCAATGTAACTACAGTAAGGGAATATCTTCCAGAAGGAGATTTCTCCATAATGACAGAGATGCTTAAAAAGT

TCTTAAGCTTCATGAATCTTACG TGTGCTGTTGGAACAACAGGCCAGAAGTCTATCTCTAGAGTGATTGAATATTTGGAACATTGCTAGCTGCTTTACC

TTTGCTTCAGGTGCTTGGTAATGCTGAAGCTATCCTTAGACAAAGAAAAGACATGAAAGAAGTCCTTGAAGATATACCAAGAACATTCATCAGTATCATT

CATTCGTGTTTGGATTTTTATGATCACCCGATTTCTTCATCATGCATTCTGCGTTTGCTAAATGACAGTTACTACATCAATCTGCAGCTATCAAAAATGA

GGGAAAAGGTTCAGGCTGTTAACAATCCCATGCAGTATTTAAATACACTTACTTGGCAGAGTCTATACCTGCCCCTGTTTCCTTGCTGTATTTCAGGCAA

GGTTTAAAGAGGGCAATTTGTGCTGCTGTTAGTGCAACTGCTGTGTATGTTGAGCCACTGTTGTCATGCCAGTCAGGTGCAAAGGCAGCTTAGCTACTGA

GGTATTGAATGTTCTGAGGACATTCTAGACAACAGCTTAGATCCTTTTTCAGGCTCATTTGCTTTTGCTTTTTGTTGAATGATTCCAATCGTAAATAAAG

CTTTTAATAATTTTGTG
Translation
 - UNI5570 - - UNI13210 - MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEEDTGDPFG

FDSDDESLPVSSKNLAQGKGSSYSESSEAAQLEEVTSVFEANSKCSHVVGEDSFASDRCLLVEDTLIGKEKSISRIPEDNANKSSCTKLLTSD - UNI5

570 - - UNI36419 - DKVENFSEEHEKNSHHFHKNAEDSTKKPNAETAVASEYKADETKETNDTWNSQSGKRTESPSESCPVKGSVRTGLYEWDND

FEDIRSEDCILSLDNESLLEMKDEDLKNRIGGLENLNETFEEDIIQSVLRPSNCRTYCRANKARSSQGASNFDKLMDGTSQSLAKANSESSKDGLNQAKK

GSASCGTSFRGTVGRTRDYTVLHPSCLSVCNVTIQDTMERSMDEFTASTPADLGEAGRLRKKADIATSKTTTRFRPSNTKSKKDVKLEFFGFEDHDETGG

DEGGSGSSNYKIKYFGFDDLSESEDDDDDDCQVERKKDKKRTKTAPSPSQQPPPESSDNSQDSQSSTNNAE - UNI4019 - - UNI4447 - - UN

I18374 - - UNI32011 - ENLDFTEDLPGVPESVKKPISKQGDKSKENTRKIFSGPKR - UNI4014 - - UNI4019 - - UNI18374 - 

SPTKAVYNARHWNHPDSEELPGPPIAKPQRVT - UNI25664 - VRLSSKEPNQKDDGVFKAPAPPLKVIKTVTIPTQPYQEIVTALKCRKEDKE - 

UNI25375 - - UNI25664 - LYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLS - UNI25375 - SVISLATKCAMPSFRM

HLRAHGMVAMVFKTLDDSQHHQ NLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKHLDLENIT 

TGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKV - UNI5598 - VKECVDHLSRDDEDEEKLVASLWGAERCLRVLES VTVHNPENQSYLIA

YKDSQLIISSAK - UNI10450 - KALQHCEDLIQQYNRAENSICVADSNPLPYQNVTNHVGKAVEDCMRAIIGVLLNLTNDNE EWGSTKTGEQEGL

IGTAMNCVLQVPKYLPQEQRFDIRVL GLGLLINLVEYSARNRHCLVNMQTSCSFDSSFSSGEGDHSLRLAGQVHAVQALVQ LFLERERAAQLAESKTD

ELIKDAPTTQHDKSGEWQETSGEIQWVSTEKTDGAEEKQKKEEEDEELDLNKA ALQHAGKHMEDCIVASYTALLLGCLCQESP INVTTVREYLPEGDF

SIMTEMLKKFLSFMNLT CAVGTTGQKSISRVIEYLEHC

For any suggestions or comments, please send an email to unitrap@crg.es