Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041429 (Nthl1)
Chromosomal location
Chr 17: 24769655 - 24775782 (+)
Description
nth (endonuclease III)-like 1 (E.coli) Gene [Source:MGI Symbol;Acc:MGI:1313275]
RefSeq_dna
NM_008743 
RefSeq_peptide
NP_032769.1 
UniGene
Mm.148315 
MGI
MGI:1313275 
Uniprot/SWISSPROT
O35980 
Uniprot/SPTREMBL
B2RSG2 
Human Ortholog
ENSG00000065057 (NTHL1)
Omim not available
UniTrap UNI13079
Vector Insertion
Chr 17: 24769800 - 24770871
Public Clones CMHD-GT_342C6-3 (cmhd) IST11081H6 (tigm)
Private Clones OST292892 (lexicon) OST285876 (lexicon) OST232616 (lexicon) OST102472 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15847
Vector Insertion
Chr 17: 24772693 - 24775368
Public Clones not available
Private Clones OST471810 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18566
Vector Insertion
Chr 17: 24775475 - 24775552
Public Clones not available
Private Clones OST420500 (lexicon) OST413048 (lexicon) OST375795 (lexicon) OST180970 (lexicon)
OST53038 (lexicon) OST53036 (lexicon) OST27469 (lexicon) OST14927 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047611
Sequence
GGGATCGCGGGGCTGCTCGGAGGAGTAGTTTACAGCCCAGGCATGAACTCAGGGGTGCGGATGGTGACTCGCAGTCGGAGCCGCGCGACTAGGATCGCGT

CGGAAGGGTGTAGGGAGGAGCTCGCCCCGCGAGAGGCTGCTGCAG - UNI13079 - AAGGAAGAAAAAGCCACAGGCCCGTGAGACATCCACGGAGA

ACACAGAAAACGCATGTGGCCTATGAAGCGGCTAATGGTGAGGAAGGCGAAGATGCTGAGCCCCTCAAAGTGCCCGTTTGGGAGCCCCAGAACTGGCAGC

AGCAACTGGCCAACATCCGCATCATGAGAAGCAAGAAGGATGCACCTGTGGACCAGCTAGGCGCCGAGCACTGCTATGATGCAAGTGCCTCCCCGAAG G

TGAGGAGGTACCAGGTACTCCTGTCGCTGATGCTCTCCAGCCAGACCAAAGACCAGGTCACAGCAGGTGCTATGCAACGGCTCCGGGCCCGGGGCTTGAC

TGTGGAGAGCATCCTGCAGACCGATGATGACACGCTAGGCAGACTCATCTACCCTGTGGGCTTCTGGAGG AACAAGGTAAAATACATCAAGCAGACAAC

CGCCATCCTGCAGCAGCGCTACGAAGGGGACATCCCTGCTTCCGTGGCTGAGCTGGTAGCCTTGCCAGGTGTTGGGCCCAAGATGGCACACTTGGCTATG

GCTGTGGCCTGGGGGACCATATCAGGCATAG - UNI15847 - CAGTGGACACACATGTGCACAGAATAGCCAACCGACTGAGGTGGACCAAGAAGAT

GACCAAGACCCCAGAAGAGACACGTAAGAACTTGGAAGAGTGGCTACCCAG - UNI18566 - GGTGCTGTGGAGTGAGGTCAACGGACTACTGGTAG

GCTTCGGCCAACAGATCTGTCTTCCTGTCCATCCTCGATGTCAGGCTTGCCTCAACAAGGCCCTGTGCCCTGCTGCCCAGGATCTCTAAGGGCCATAGGG

CTTCCTCTGGCTAGTGTCTGTGAGGTGCCTTTGTGGGGCGGGGTGGTAAACTTTGGGGGGTGTTTGCAATAAACCTGGGAAGTTTTTCACAGTTG
Translation
MNSGVRMVTRSRSRATRIASEGCREELAPREAAAE - UNI13079 - EGRKSHRPVRHPRRTQKTHVAYEAANGEEGEDAEPLKVPVWEPQNWQQQLA

NIRIMRSKKDAPVDQLGAEHCYDASASPK VRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVESILQTDDDTLGRLIYPVGFWR NKVKYIKQTTAI

LQQRYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTISGIA - UNI15847 - AVDTHVHRIANRLRWTKKMTKTPEETRKNLEEWLPR - UNI18

566 - RVLWSEVNGLLVGFGQQICLPVHPRCQACLNKALCPAAQDL

For any suggestions or comments, please send an email to unitrap@crg.es