Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041431 (Ccnb1)
Chromosomal location
Chr 13: 101548702 - 101556451 (-)
Description
cyclin B1 Gene [Source:MGI (curated);Acc:Ccnb1-001]
RefSeq_dna
NM_172301 
RefSeq_peptide
NP_758505.2 
UniGene
Mm.302012 Mm.401674 Mm.260114 Mm.380027 Mm.469674 
MGI
MGI:88302 
Uniprot/SWISSPROT
P24860 
Uniprot/SPTREMBL
Q68EM3 Q3TFV6 Q3TQW9 Q3UWL3 
Human Ortholog
ENSG00000134057 (CCNB1)
Omim not available
UniTrap UNI23140
Vector Insertion
Chr 13: 101555859 - 101556336
Public Clones not available
Private Clones OST275233 (lexicon) OST266114 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16207
Vector Insertion
Chr 13: 101555574 - 101555687
Public Clones PST23593-NR (escells)
Private Clones OST465144 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9054
Vector Insertion
Chr 13: 101553603 - 101555411
Public Clones XK056 (baygenomics) PST18733-NR (escells) PST17360-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11114
Vector Insertion
Chr 13: 101551739 - 101553419
Public Clones G049D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37818
Vector Insertion
Chr 13: 101551112 - 101551739
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4630
Vector Insertion
Chr 13: 101550872 - 101551112
Public Clones AS0071 (sanger) RRX058 (baygenomics) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37785
Vector Insertion
Chr 13: 101549976 - 101550872
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091295
Sequence
GTGCTGCGGAGGAACGGCTGTTAGTGTTTAGCTGTGGATAGCCAGAGGTTAGGGTGTCTTCTCGAATCGGGGAACCTCTGATTTTGGAGGAGCCATGGCG

CTCAGGGTCACTAGG - UNI23140 - AACACGAAAATTAACGCAGAAAATAAGGCCAAGGTCAGTATGGCAGGCGCCAAGCGTGTGCCTGTGACAGT

TACTGCTGCTTCCAAGCCCGGGCTGAGACCGAGAACTGCTCTTGGAGACATTGGTAATAAAGTCAGCGAAGAGCTACAGGCAAGAGTGCCTCTGAAAAGG

 - UNI16207 - GAAGCAAAAACGCTAGGTACTGGAAAAGGTACTGTTAAAGCCCTACCAAAACCTGTAGAGAAGGTGCCTGTGTGTGAACCAGAGGT

GGAACTTGCTGAGCCTGAGCCTGAACCTGAACTTGAACATGTTAGAGAAGAGAAGCTTTCTCCTGAACCTATTTTG - UNI9054 - - UNI11114 

- GAAGAGCAGTCAGTTAGACCAAAATACCTACAGGGTCGTGAAGTGACTGGAAACATGAGAGCTATCCTCATTGACTGGCTAATACAGGTTCAGATGAA

ATTTAGGCTGCTTCAGGAGACCATGTACATGACTGTGTCCATTATTGATCGGTTCATGCAG AACAGTTGTGTGCCCAAGAAGATGCTACAGCTGGTCGG

TGTAACGGCCATGTTTATTGCAAGCAAATATGAGGAGATGTACCCTCCAGAAATAGGTGACTTCGCCTTTGTGACTAACAACACGTACACTAAGCACCAG

ATCAGACAGATGGAGATGAAGATTCTCAGAGTTCTGAACTTCAGCCTGGGTCGCCCTCTGCCTCTGCACTTCCTCCGTAGAGCATCTAAAGTCGGAGAG 

- UNI4630 - GTTGACGTCGAGCAGCACACTTTGGCCAAATACCTCATGGAGCTCTCCATGCTGGACTACGACATGGTGCATTTTGCTCCTTCTCAAA

TTGCAGCTGGGGCTTTCTGCTTAGCGCTGAAAATTCTTGACAACGGTGAATGG ACACCAACTCTGCAGCACTACCTATCCTACAGTGAAGACTCCCTGC

TTCCTGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTGAACTGTGGCCTCACAAAGCACATG ACTGTCAAGAACAAGTATGCAGCATCTAAGCATG

CTAAGATCAGCACGCTGGCACAGCTGAACTGTACACTAGTTCAGAATTTGTCTAAGGCCGTGACAAAGGCATAACTCCAATAGACTGCTACATCTGCAGA

TGCAGTTGGCACCATGTGCCGCCTGTACATAGGATACCTACCGTGTTTACTTGCTCTTCAATAAAGGTTGTGACTTCTCATTTTACATAGCTTAACTCAT

TTGAATGTTGTTGCTTCTGAGTTTAGGCTAACGGAAGTTGTCGAATTTAGGAGTATATTAAAAACTGCATCTAGTTTTAACAGTGGATCCAACTAATGTA

TATATCTGTAGCCTATATGTCTATATACATCCTTCACTGTGTGTCCTTATATCATCATGTCTTCTGCCTCACTCTAGTTTAAACTCTAAATCTACCAGCT

AGTCCTTTGTTCCATTTTCCAGTGGTTGCCACCTTTAACCACTGTCTCTTGGTTTGTCAACTTTCAGATCTGAAACCAAGTATCTTTTTTTATGTAATTA

TTTATTTGTTCTTAATTGGAAAATAGGATGTTCAAAATTAAAGGTGTGTTTTAAAAAGAATTTGCCCCCAAGTCTCACTATCAACAGATAAGGGTGTATT

CTTGTATATCCTGTATAGATATAATCATGCATATACTCCCAAGGAGATATTTTTATATGGGTTCATTTTATCAACAGTATTCCTATCAGCATTCCTTTCA

ATGCCTATATTGCATTTCCTAGTGTGAACAAACTGTGTGTAACATAGTCATTCCCTCGGTGGGATTCAAGTGCATTCTCTCAGTGCCCTCCACAGTGTTC

TTAAATGATGTTTAATGTCTTGCTTGGCTTCATTCATAGTAGCTCTTCCAGGGGTGTGCTTTGAATTCTGACAGCCAGATGGGTGTGGCTGCCACCATAC

CAAGGCGCCACTCCTGTCTTGTAATGCCACCTGGAAAAGAATCCTGTCTCATTTGCTGTTTTAATTTATACATCTGATATCAAGTTGAATAAAATTTATT

GGTGG
Translation
MALRVTR - UNI23140 - NTKINAENKAKVSMAGAKRVPVTVTAASKPGLRPRTALGDIGNKVSEELQARVPLKR - UNI16207 - EAKTLGTG

KGTVKALPKPVEKVPVCEPEVELAEPEPEPELEHVREEKLSPEPIL - UNI9054 - - UNI11114 - EEQSVRPKYLQGREVTGNMRAILIDWLI

QVQMKFRLLQETMYMTVSIIDRFMQ NSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRA

SKVGE - UNI4630 - VDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKILDNGEW TPTLQHYLSYSEDSLLPVMQHLAKNVVMVNCGLT

KHM TVKNKYAASKHAKISTLAQLNCTLVQNLSKAVTKA
Transcript ENSMUST00000072119
Sequence
GTGCTGCGGAGGAACGGCTGTTAGTGTTTAGCTGTGGATAGCCAGAGGTTAGGGTGTCTTCTCGAATCGGGGAACCTCTGATTTTGGAGGAGCCATGGCG

CTCAGGGTCACTAGG - UNI23140 - AACACGAAAATTAACGCAGAAAATAAGGCCAAGGTCAGTATGGCAGGCGCCAAGCGTGTGCCTGTGACAGT

TACTGCTGCTTCCAAGCCCGGGCTGAGACCGAGAACTGCTCTTGGAGACATTGGTAATAAAGTCAGCGAAGAGCTACAGGCAAGAGTGCCTCTGAAAAGG

 - UNI16207 - GAAGCAAAAACGCTAGGTACTGGAAAAGGTACTGTTAAAGCCCTACCAAAACCTGTAGAGAAGGTGCCTGTGTGTGAACCAGAGGT

GGAACTTGCTGAGCCTGAGCCTGAACCTGAACTTGAACATGTTAGAGAAGAGAAGCTTTCTCCTGAACCTATTTTG - UNI9054 - GTTGATAATCC

CTCTCCAAGCCCGATGGAAACATCTGGATGTGCGCCTGCAGAAGAGTATCTGTGTCAGGCTTTCTCTGATGTAATCCTTGCAGTGAGTGACGTAGACGCA

GATGATGGGGCTGACCCAAACCTCTGTAGTGAATATGTGAAAGATATCTATGCTTATCTCCGACAACTGGAG - UNI11114 - GAAGAGCAGTCAGT

TAGACCAAAATACCTACAGGGTCGTGAAGTGACTGGAAACATGAGAGCTATCCTCATTGACTGGCTAATACAGGTTCAGATGAAATTTAGGCTGCTTCAG

GAGACCATGTACATGACTGTGTCCATTATTGATCGGTTCATGCAG AACAGTTGTGTGCCCAAGAAGATGCTACAGCTGGTCGGTGTAACGGCCATGTTT

ATTGCAAGCAAATATGAGGAGATGTACCCTCCAGAAATAGGTGACTTCGCCTTTGTGACTAACAACACGTACACTAAGCACCAGATCAGACAGATGGAGA

TGAAGATTCTCAGAGTTCTGAACTTCAGCCTGGGTCGCCCTCTGCCTCTGCACTTCCTCCGTAGAGCATCTAAAGTCGGAGAG - UNI4630 - GTTG

ACGTCGAGCAGCACACTTTGGCCAAATACCTCATGGAGCTCTCCATGCTGGACTACGACATGGTGCATTTTGCTCCTTCTCAAATTGCAGCTGGGGCTTT

CTGCTTAGCGCTGAAAATTCTTGACAACGGTGAATGG ACACCAACTCTGCAGCACTACCTATCCTACAGTGAAGACTCCCTGCTTCCTGTTATGCAGCA

CCTGGCTAAGAATGTAGTCATGGTGAACTGTGGCCTCACAAAGCACATG ACTGTCAAGAACAAGTATGCAGCATCTAAGCATGCTAAGATCAGCACGCT

GGCACAGCTGAACTGTACACTAGTTCAGAATTTGTCTAAGGCCGTGACAAAGGCATAACTCCAATAGACTGCTACATCTGCAGATGCAGTTGGCACCATG

TGCCGCCTGTACATAGGATACCTACCGTGTTTACTTGCTCTTCAATAAAGGTTGTGACTTCTCATTTTACATAGCTTAACTCATTTGAATGTTGTTGCTT

CTGAGTTTAGGCTAACGGAAGTTGTCGAATTTAGGAGTATATTAAAAACTGCATCTAGTTTTAACAGTGGATCCAACTAATGTATATATCTGTAGCCTAT

ATGTCTATATACATCCTTCACTGTGTGTCCTTATATCATCATGTCTTCTGCCTCACTCTAGTTTAAACTCTAAATCTACCAGCTAGTCCTTTGTTCCATT

TTCCAGTGGTTGCCACCTTTAACCACTGTCTCTTGGTTTGTCAACTTTCAGATCTGAAACCAAGTATCTTTTTTTATGTAATTATTTATTTGTTCTTAAT

TGGAAAATAGGATGTTCAAAATTAAAGGTGTGTTTTAAAAAGAATTTGCCCCCAAGTCTCACTATCAACAGATAAGGGTGTATTCTTGTATATCCTGTAT

AGATATAATCATGCATATACTCCCAAGGAGATATTTTTATATGGGTTCATTTTATCAACAGTATTCCTATCAGCATTCCTTTCAATGCCTATATTGCATT

TCCTAGTGTGAACAAACTGTGTGTAACATAGTCATTCCCTCGGTGGGATTCAAGTGCATTCTCTCAGTGCCCTCCACAGTGTTCTTAAATGATGTTTAAT

GTCTTGCTTGGCTTCATTCATAGTAGCTCTTCCAGGGGTGTGCTTTGAATTCTGACAGCCAGATGGGTGTGGCTGCCACCATACCAAGGCGCCACTCCTG

TCTTGTAATGCCACCTGGAAAAGAATCCTGTCTCATTTGCTGTTTTAATTTATACATCTGATATCAAGTTGAATAAAATTTATTGGTGG
Translation
MALRVTR - UNI23140 - NTKINAENKAKVSMAGAKRVPVTVTAASKPGLRPRTALGDIGNKVSEELQARVPLKR - UNI16207 - EAKTLGTG

KGTVKALPKPVEKVPVCEPEVELAEPEPEPELEHVREEKLSPEPIL - UNI9054 - VDNPSPSPMETSGCAPAEEYLCQAFSDVILAVSDVDADDGA

DPNLCSEYVKDIYAYLRQLE - UNI11114 - EEQSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQ NSCVPKKMLQLV

GVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRASKVGE - UNI4630 - VDVEQHTLAKYLMELSMLDY

DMVHFAPSQIAAGAFCLALKILDNGEW TPTLQHYLSYSEDSLLPVMQHLAKNVVMVNCGLTKHM TVKNKYAASKHAKISTLAQLNCTLVQNLSKAVTK

A

For any suggestions or comments, please send an email to unitrap@crg.es