Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041438 (Cirh1a)
Chromosomal location
Chr 8: 109417534 - 109446987 (+)
Description
cirrhosis, autosomal recessive 1A (human) Gene [Source:MGI Symbol;Acc:MGI:1096573]
RefSeq_peptide
NP_035704.2 
UniGene
Mm.10665 Mm.402485 
MGI
MGI:1096573 
Uniprot/SWISSPROT
Q8R2N2 
Uniprot/SPTREMBL
Q3UJY3 
Human Ortholog
ENSG00000141076 (CIRH1A)
Omim 604901 - NORTH AMERICAN INDIAN CHILDHOOD CIRRHOSIS  
UniTrap UNI20946
Vector Insertion
Chr 8: 109417613 - 109418487
Public Clones (sanger) H008E02 (ggtc)
Private Clones OST347673 (lexicon) OST35334 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8867
Vector Insertion
Chr 8: 109418490 - 109418550
Public Clones XM103 (baygenomics) W025B09 (ggtc) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29823
Vector Insertion
Chr 8: 109418652 - 109421959
Public Clones E057G09 (ggtc) IST14438F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12364
Vector Insertion
Chr 8: 109422152 - 109422341
Public Clones W081C04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38652
Vector Insertion
Chr 8: 109428345 - 109430024
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9776
Vector Insertion
Chr 8: 109432202 - 109434841
Public Clones XH230 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5567
Vector Insertion
Chr 8: 109437405 - 109440055
Public Clones YTA252 (baygenomics)
Private Clones OST468123 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27985
Vector Insertion
Chr 8: 109441578 - 109442519
Public Clones not available
Private Clones OST42960 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4389
Vector Insertion
Chr 8: 109442706 - 109446071
Public Clones AE0491 (sanger) IST10194A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047629
Sequence
GGTTGGCGAGTTCCCGGCGGTAG - UNI8867 - - UNI20946 - GAATGGGTGAATTTAAGGTCCATCGAGTACGTTTCTTTAATTACGTTCCAT

CAGGTATCCGGTGTGTGGCTTACAATAATCAGTCAAACAGATTGGCTGTTTCACGAACAGATGGCACGGTGGAAATTTATAACTTGTCAGCAAACTATTT

TCAGGAGAAA - UNI29823 - TTTTTCCCAGGTCATGAGTCTCGGGGTACCGAAGCCCTGTGTTGGGCAGGAGGACAGCGGCTCTTTAGTGCTGGAC

TGAACGGAGAAATCCTTGAGTATGACCTACAGGCACTAAACATCAAGTACACTTTGGATGCCTTTGGAGGACCCATCTGGAGTATGACCGCCAGCCCCAG

TGGCTCTCAACTTTTG - UNI12364 - GTTGGTTGTGAAGATGGCTCCGTGAAACTATTTGAAGTCACCCCAGAAAAAATCCAGTTTGCAAGAAATT

TTGATCGGCAAAAAA GTCGGATTCTCAGTCTCTGCTGGCACCCTGCGGGTACCCACGTCGCAGCTGGTTCCTTAGACTACATTAGCGTGTTTGATGTCA

AATCAG GGAGCATAATTCGTAAGATGGTTTTAGATAGGCAACACCTGGGAGTGACTAAGTCCAGGTGCATAGTGTGGGGTGTTGCCTTCTTGTCCGACG

GCACTGTCATAAGTGTGGACTCTGTTGGAAAGGTGCAGTTGTGGGACTCTGCTACTGGGACACTCGTTAAGAGTCATCTCGTCGCAAATGCTGATGTGCA

GTCTATTGCTGTTGCTGAT CAAGAAGACAGTTTTGTGGTGGGCACCGCCGAGGGCACGGTATTCCATTTCCAGCTGGTGTCCATGACTTCCAACAGCAG

TGAGAAGCAGTGGGTGCGGACGAAACCGTTCCAGCATCACACTCATGACGTGCGTGCTGTGGCCCACAGCCCAACAGCCCTGATCTCAGGAG GCACCGA

CACCCACCTGGTTATTCGGCCTCTCATGGAGAGAGTGGAGGTAAAGAATTACGATGCTGCTCTCCGAAAGATCACGTTCCCCCAT CGGCGTCTCATTTC

CTGTTCAAAAAGAAGGCAGCTTCTCCTTTTCCAGTTCGCGCATCACTTGGAACTGTGGAGACTAGGATCCACATCTGCAACAG - UNI9776 - GCAA

GAACGGAGATACTCTTCCACTCTCTAAAAACGCAGATCATCTCCTGCACCTCAAGACAAAG GGCCCTGAGAACATTATCTGCAGCTGTGTCTCCCCGTG

TGGAAGCTGGATAGCCTATTCTACAGCGTCTCGCTTTTTTCTCTATCGATTGAAATATGAACGCGATAACATAAGCCTCCAAAGA GTTTCCAAATTGCC

ATCATTCCTGCGCTCTGCCCTTCATATTCTGTTTTCTGAAGATTCAACAAAGCTCCTTGTGGCATCCAATCAAGGGTCTCTGCATATTGTTCATCTGTCG

GAAGGAAGCTTCAAGCACTTGCATACTTTCCAGCCGCAGTCAG - UNI5567 - GTACAGTGGAGGCCATGTGTCTTTTGGCAGTCAGTCCAGATGGG

AACTGGCTAGCTGCATCGGGTACCAGTGCTGGAGTCCACGTATATGATCTGCATCATCTAAAG CTTCACTGCACAGTGCCTGCTTACAACTTCCCAGTG

ACCGCTCTGGCCATCGCCCCCAATACCAACAACCTGGTCATTGCTCATTCTGACCAGCAG - UNI27985 - GTATTTGAATTCAGCATCCCAGAAAA

GCAGTATACAGAGTGGAGCCGCTCTCTCCAGAAGCAAGGATTTCACCAGCTGTGGCTCCAAAGGGATACTCCCATCACACACATCAGCTTTCATCCCAAG

AGACCAATGCACATCCTCCTCCATGATGCCTACATGTTCTGCATCATTGACAAGTCATTG - UNI4389 - CCACTTCCAAATGAGAAAACTGTGCTT

TATAATCCACTTCCTCCGAAAAATGAATCAGATGTCTTCTTGAGGCGGACAACCCATGGGTTTAAAATGTCAAAGATATATAAG CCCTTGCTCTTTATG

GATCTTTTGGATGAAAGGACACTTGTGGCAGTAGAGCGACCCCTGGACGACATCATTGCTCAACTCCCACCACCCATCAAAAAGAAGAAATTTGGAACTT

AAAACAGGGCACTGTCTGTGTCCTTTCTTGAACTGTCTATCCTGTTGTTTTGTTTGTTTGTTTGTTTGTTTTTTCCCAAATCATGATAATAAAACAAAGT

TATTCTTT
Translation
 - UNI8867 - - UNI20946 - MGEFKVHRVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEK - UNI29823 - FFPGHES

RGTEALCWAGGQRLFSAGLNGEILEYDLQALNIKYTLDAFGGPIWSMTASPSGSQLL - UNI12364 - VGCEDGSVKLFEVTPEKIQFARNFDRQKS

 SRILSLCWHPAGTHVAAGSLDYISVFDVKSG GSIIRKMVLDRQHLGVTKSRCIVWGVAFLSDGTVISVDSVGKVQLWDSATGTLVKSHLVANADVQSI

AVAD QEDSFVVGTAEGTVFHFQLVSMTSNSSEKQWVRTKPFQHHTHDVRAVAHSPTALISGG GTDTHLVIRPLMERVEVKNYDAALRKITFPH RRLI

SCSKRRQLLLFQFAHHLELWRLGSTSATG - UNI9776 - GKNGDTLPLSKNADHLLHLKTK GPENIICSCVSPCGSWIAYSTASRFFLYRLKYERD

NISLQR VSKLPSFLRSALHILFSEDSTKLLVASNQGSLHIVHLSEGSFKHLHTFQPQSG - UNI5567 - GTVEAMCLLAVSPDGNWLAASGTSAGV

HVYDLHHLK LHCTVPAYNFPVTALAIAPNTNNLVIAHSDQQ - UNI27985 - VFEFSIPEKQYTEWSRSLQKQGFHQLWLQRDTPITHISFHPKRP

MHILLHDAYMFCIIDKSL - UNI4389 - PLPNEKTVLYNPLPPKNESDVFLRRTTHGFKMSKIYK PLLFMDLLDERTLVAVERPLDDIIAQLPPPI

KKKKFGT
Transcript ENSMUST00000098435
Sequence
GCTGTCGAGTGCGCAAGCGCGCACGTGGGGCCGGGG GAGAGAAGCGAGGTCCGGGGTTGGCGAGTTCCCGGCG - UNI20946 - CAGGAATGGGTG

AATTTAAGGTCCATCGAGTACGTTTCTTTAATTACGTTCCATCAGGTATC
Translation
AVECASAHVGPG ERSEVRGWRVPGA - UNI20946 - AGMGEFKVHRVRFFNYVPSGI

For any suggestions or comments, please send an email to unitrap@crg.es