Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041440 (Gk5)
Chromosomal location
Chr 9: 96019794 - 96085046 (+)
Description
glycerol kinase 5 (putative) Gene [Source:MGI (curated);Acc:Gk5-001]
RefSeq_peptide
NP_796326.1 
UniGene
Mm.213651 Mm.398351 
MGI
MGI:2443336 
Uniprot/SWISSPROT
Q8BX05 
Human Ortholog
ENSG00000175066 (GK5)
Omim not available
UniTrap UNI23867
Vector Insertion
Chr 9: 96020032 - 96029419
Public Clones not available
Private Clones OST242032 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20076
Vector Insertion
Chr 9: 96038258 - 96040957
Public Clones IST10889B5 (tigm) IST14294C1 (tigm) IST12062C9 (tigm)
Private Clones OST373679 (lexicon) OST354086 (lexicon) OST70936 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31228
Vector Insertion
Chr 9: 96041090 - 96046090
Public Clones IST12793C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5014
Vector Insertion
Chr 9: 96055917 - 96071878
Public Clones (sanger) YTC431 (baygenomics) IST13098F8 (tigm) IST13105F6 (tigm)
Private Clones OST435847 (lexicon) OST435489 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19706
Vector Insertion
Chr 9: 96071974 - 96075108
Public Clones not available
Private Clones OST383096 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112972
Sequence
TGCAGTGTTCGGGGTCGCGATGTCAGGGCAGCAGGAGCGTGCAGAGCGGCAGCGAGAGGAACTGAGCGCGTCGGCCTCGCCGCCCTCCCGCTTCGTGCTG

GGGCTGGACGTGGGCAGCACGGTGATCCGCTGCCACGTCTATGACCAGACGGCGCGAGTGCGAGGCTCCAGCGCGCAGAAG - UNI23867 - GTAGA

AAATGTTTACCCTCAACCTGGCTGGGTTGAAATCGATCCTGATTCTCTCTGGGCTCAGTTTGTTGCCGTAATAAAAGATGCTGTCAAAG CTGCAGGGGT

GCAGATGAATCAAATTGTCGGTCTTGGCATATCAACACAGAGAGCCACTTTCATTACATGGAACAA GAAAACAGGCCATCATTTTCACAACTTCATTAG

CTGGCAAGACCTAAGGGCAGCTGAACTTGTAAAGTCCTGGAATAATTCTCTCATAATGAAG - UNI20076 - CTATTGCATGGGGCCACCCGAGTCC

TTCATTTCTTCAGTAGAAGTAAAGTAATGCTAACGGTCAGCCGCTTCAATTTCAGCACCCAGCATGCCACCTTAAGATTGACCTGGATTTTACAAAACCT

ATCTGAG - UNI31228 - GTGAAAAGGGCAGTTGAAGAAGACAATTGTTGCTTTGGGACGATTGATACCTGGCTGTTATACAAGCTCACGAAAG GT

TCTTCCTACGCCACGGATTATTCAAATGCCAGCACCACTGGATTTTTTGATCCCTATGCG ATGCGCTGGAGCAGGCTCATAACCACCATGGTCTCCATC

CCACTGTCTATCCTGCCTCCTGTGAAGGATACCAG CTATAATTTTGGATCAGTGGATGAGAAGATATTTGGCGTGCCTATACCAGTTGTTGCCTTG GT

TGGTGACCAGCAGTCGGCCATGTTTGGAGAGTGCTGCTTCGAGACGGGAGATGTGAAGCTAACCATGGGAACTGGAACATTTTTGGATATCAATACTGGA

AAAAACCTTCAGCATGTTAATGGAG GCTTTTATCCACTAATTGGATGGAAGATTGGGCAAGAACTTGTATGTTTAGCTGAAGGCAATGCAGGAGACACG

GGCACCGCCATAATGTGGGCTCAAAAATTAG - UNI5014 - ATCTCTTCACAGACGCTGCTGAGACTGAAAAAATGGCCCTGAGCCTGGAAGATTCT

GAAGGGGTTTACTTTGTTCCGTCGTTTAGTGGATTACAG - UNI19706 - GCTCCATTAAATGACCCCTGTGCCTGTGCCTCTTTTATGGGTTTGAA

GCACTCCACTAATAAATACCATCTTGTCCGAGCAATATTGGAGTCAATAGCTTTCAG GAACAAACAGTTGTACGACATGCTGCAGAGAGAAATCCAGAT

TCCCGTCACGAACATCCG GGCAGATGGAGGCGTGTGTAACAACGCTTTCGTCATGCAGATGACTTCAGACCTGATAAATGAGAAGATAGACAGACCTGC

CCACTTCGACATGTCCTGCTTGGGGGCAGCCTCTCTGGCTGGCCTCGCTGTTG GATTTTGGGCGGACAAGGAAGAGCTCCAGAAGCTGAGGCAAAGCGA

GATGGTTTTCAAGCCTCAGAAGAAGTGGCAGGAATACGAG CGATTT
Translation
MSGQQERAERQREELSASASPPSRFVLGLDVGSTVIRCHVYDQTARVRGSSAQK - UNI23867 - VENVYPQPGWVEIDPDSLWAQFVAVIKDAVKA

 AAGVQMNQIVGLGISTQRATFITWNK KKTGHHFHNFISWQDLRAAELVKSWNNSLIMK - UNI20076 - LLHGATRVLHFFSRSKVMLTVSRFNF

STQHATLRLTWILQNLSE - UNI31228 - VKRAVEEDNCCFGTIDTWLLYKLTKG GSSYATDYSNASTTGFFDPYA MRWSRLITTMVSIPLSILP

PVKDTS SYNFGSVDEKIFGVPIPVVAL VGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNGG GFYPLIGWKIGQELVCLAEGNAGDTGT

AIMWAQKLD - UNI5014 - DLFTDAAETEKMALSLEDSEGVYFVPSFSGLQ - UNI19706 - APLNDPCACASFMGLKHSTNKYHLVRAILESI

AFR RNKQLYDMLQREIQIPVTNIR RADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVG GFWADKEELQKLRQSEMVFKPQKKWQE

YE RF
Transcript ENSMUST00000085217
Sequence
TGCAGTGTTCGGGGTCGCGATGTCAGGGCAGCAGGAGCGTGCAGAGCGGCAGCGAGAGGAACTGAGCGCGTCGGCCTCGCCGCCCTCCCGCTTCGTGCTG

GGGCTGGACGTGGGCAGCACGGTGATCCGCTGCCACGTCTATGACCAGACGGCGCGAGTGCGAGGCTCCAGCGCGCAGAAG - UNI23867 - GTAGA

AAATGTTTACCCTCAACCTGGCTGGGTTGAAATCGATCCTGATTCTCTCTGGGCTCAGTTTGTTGCCGTAATAAAAGATGCTGTCAAAG CTGCAGGGGT

GCAGATGAATCAAATTGTCGGTCTTGGCATATCAACACAGAGAGCCACTTTCATTACATGGAACAA GAAAACAGGCCATCATTTTCACAACTTCATTAG

CTGGCAAGACCTAAGGGCAGCTGAACTTGTAAAGTCCTGGAATAATTCTCTCATAATGAAG - UNI20076 - CTATTGCATGGGGCCACCCGAGTCC

TTCATTTCTTCAGTAGAAGTAAAGTAATGCTAACGGTCAGCCGCTTCAATTTCAGCACCCAGCATGCCACCTTAAGATTGACCTGGATTTTACAAAACCT

ATCTGAG - UNI31228 - GTGAAAAGGGCAGTTGAAGAAGACAATTGTTGCTTTGGGACGATTGATACCTGGCTGTTATACAAGCTCACGAAAG GT

TCTTCCTACGCCACGGATTATTCAAATGCCAGCACCACTGGATTTTTTGATCCCTATGCG ATGCGCTGGAGCAGGCTCATAACCACCATGGTCTCCATC

CCACTGTCTATCCTGCCTCCTGTGAAGGATACCAG CTATAATTTTGGATCAGTGGATGAGAAGATATTTGGCGTGCCTATACCAGTTGTTGCCTTG GT

TGGTGACCAGCAGTCGGCCATGTTTGGAGAGTGCTGCTTCGAGACGGGAGATGTGAAGCTAACCATGGGAACTGGAACATTTTTGGATATCAATACTGGA

AAAAACCTTCAGCATGTTAATGGAG GCTTTTATCCACTAATTGGATGGAAGATTGGGCAAGAACTTGTATGTTTAGCTGAAGGCAATGCAGGAGACACG

GGCACCGCCATAATGTGGGCTCAAAAATTAG - UNI5014 - ATCTCTTCACAGACGCTGCTGAGACTGAAAAAATGGCCCTGAGCCTGGAAGATTCT

GAAGGGGTTTACTTTGTTCCGTCGTTTAGTGGATTACAG - UNI19706 - GCTCCATTAAATGACCCCTGTGCCTGTGCCTCTTTTATGGGTTTGAA

GCACTCCACTAATAAATACCATCTTGTCCGAGCAATATTGGAGTCAATAGCTTTCAG GAACAAACAGTTGTACGACATGCTGCAGAGAGAAATCCAGAT

TCCCGTCACGAACATCCG GGCAGATGGAGGCGTGTGTAACAACGCTTTCGTCATGCAGATGACTTCAGACCTGATAAATGAGAAGATAGACAGACCTGC

CCACTTCGACATGTCCTGCTTGGGGGCAGCCTCTCTGGCTGGCCTCGCTGTTG GATTTTGGGCGGACAAGGAAGAGCTCCAGAAGCTGAGGCAAAGCGA

GATGGTTTTCAAGCCTCAGAAGAAGTGGCAGGAATACGAGGTGAATATGGAAAACTGGGTAAAAGCGGTGAAGCGCTCCATGAATTGGTATAACAAGACG

TAG
Translation
MSGQQERAERQREELSASASPPSRFVLGLDVGSTVIRCHVYDQTARVRGSSAQK - UNI23867 - VENVYPQPGWVEIDPDSLWAQFVAVIKDAVKA

 AAGVQMNQIVGLGISTQRATFITWNK KKTGHHFHNFISWQDLRAAELVKSWNNSLIMK - UNI20076 - LLHGATRVLHFFSRSKVMLTVSRFNF

STQHATLRLTWILQNLSE - UNI31228 - VKRAVEEDNCCFGTIDTWLLYKLTKG GSSYATDYSNASTTGFFDPYA MRWSRLITTMVSIPLSILP

PVKDTS SYNFGSVDEKIFGVPIPVVAL VGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNGG GFYPLIGWKIGQELVCLAEGNAGDTGT

AIMWAQKLD - UNI5014 - DLFTDAAETEKMALSLEDSEGVYFVPSFSGLQ - UNI19706 - APLNDPCACASFMGLKHSTNKYHLVRAILESI

AFR RNKQLYDMLQREIQIPVTNIR RADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVG GFWADKEELQKLRQSEMVFKPQKKWQE

YEVNMENWVKAVKRSMNWYNKT
Transcript ENSMUST00000122383
Sequence
GAGCTCTCCGCCCGGGGTCTGGCGTTTATAGCTCCGCGCTGGCCGGCCCGTGGCGACTGCAGTGTTCGGGGTCGCGATGTCAGGGCAGCAGGAGCGTGCA

GAGCGGCAGCGAGAGGAACTGAGCGCGTCGGCCTCGCCGCCCTCCCGCTTCGTGCTGGGGCTGGACGTGGGCAGCACGGTGATCCGCTGCCACGTCTATG

ACCAGACGGCGCGAGTGCGAGGCTCCAGCGCGCAGAAG - UNI23867 - GTAGAAAATGTTTACCCTCAACCTGGCTGGGTTGAAATCGATCCTGAT

TCTCTCTGGGCTCAGTTTGTTGCCGTAATAAAAGATGCTGTCAAAG CTGCAGGGGTGCAGATGAATCAAATTGTCGGTCTTGGCATATCAACACAGAGA

GCCACTTTCATTACATGGAACAA GAAAACAGGCCATCATTTTCACAACTTCATTAGCTGGCAAGACCTAAGGGCAGCTGAACTTGTAAAGTCCTGGAAT

AATTCTCTCATAATGAAG - UNI20076 - CTATTGCATGGGGCCACCCGAGTCCTTCATTTCTTCAGTAGAAGTAAAGTAATGCTAACGGTCAGCCG

CTTCAATTTCAGCACCCAGCATGCCACCTTAAGATTGACCTGGATTTTACAAAACCTATCTGAG - UNI31228 - GTGAAAAGGGCAGTTGAAGAAG

ACAATTGTTGCTTTGGGACGATTGATACCTGGCTGTTATACAAGCTCACGAAAG GTTCTTCCTACGCCACGGATTATTCAAATGCCAGCACCACTGGAT

TTTTTGATCCCTATGCG ATGCGCTGGAGCAGGCTCATAACCACCATGGTCTCCATCCCACTGTCTATCCTGCCTCCTGTGAAGGATACCAG CTATAAT

TTTGGATCAGTGGATGAGAAGATATTTGGCGTGCCTATACCAGTTGTTGCCTTG GTTGGTGACCAGCAGTCGGCCATGTTTGGAGAGTGCTGCTTCGAG

ACGGGAGATGTGAAGCTAACCATGGGAACTGGAACATTTTTGGATATCAATACTGGAAAAAACCTTCAGCATGTTAATGGAG GCTTTTATCCACTAATT

GGATGGAAGATTGGGCAAGAACTTGTATGTTTAGCTGAAGGCAATGCAGGAGACACGGGCACCGCCATAATGTGGGCTCAAAAATTAG - UNI5014 -

 ATCTCTTCACAGACGCTGCTGAGACTGAAAAAATGGCCCTGAGCCTGGAAGATTCTGAAGGGGTTTACTTTGTTCCGTCGTTTAGTGGATTACAG - U

NI19706 - GCTCCATTAAATGACCCCTGTGCCTGTGCCTCTTTTATGGGTTTGAAGCACTCCACTAATAAATACCATCTTGTCCGAGCAATATTGGAG

TCAATAGCTTTCAG GAACAAACAGTTGTACGACATGCTGCAGAGAGAAATCCAGATTCCCGTCACGAACATCCG GGCAGATGGAGGCGTGTGTAACAA

CGCTTTCGTCATGCAGATGACTTCAGACCTGATAAATGAGAAGATAGACAGACCTGCCCACTTCGACATGTCCTGCTTGGGGGCAGCCTCTCTGGCTGGC

CTCGCTGTTG GATTTTGGGCGGACAAGGAAGAGCTCCAGAAGCTGAGGCAAAGCGAGATGGTTTTCAAGCCTCAGAAGAAGTGGCAGGAATACGAG GC

ATTTTAAGAGGACTCCAGCAAACTCAGAAAGGACAGTGTTCCTGTCTTAACGTGGCACTAACTGCATTATCTATGACTTACTGATCTTCGAGTCTCTTGT

ATTCATCAGTGGTATGGTTTCTCAGTGTCAGCATTGATCTTTGTTTTGTTTTTATGACAGGGTCTCAATGTGTAGCCCTGGCTGTCCTGGAACTCACTGT

GTAGACCAGGTTGCCTCCTCATTCACAGAACTCCGCCTGCCTCTGCCTCCTGAGTTCTGGGGTTAAAGGTGTGCACCACCACACCTTGCAACATTGACAT

TTTGAACTGCATCTGACTTTGCTTTGGGATGCTATGCTGGACACAGTGGGATGCTTGGCAGTATCCCTGACCTCCACTGTTCAGCATTCCCCTGGGTTTT

ATGGCCCCAAATGCCTGCCAACATTGGCCATCCTGGGAGGCAAAAATCATTGTCATTTGAGAACCACTGATGCAGGCTGTTAGAATAAACATGAGGATTT

GGTGAATATAGTCACATTCCCAATAGTCTATGCACTGTTTTCTCCTGGGAAATGAATTCTTAACAGTGAAAAAGTAGAGAGTATCCTAAAGTGCGGTTTC

GGTTTTGCTCGGTAATGAAGAAAAAGTGTTGGTTGGTTGTGTCCCTTACCCATCACCTCTGAAGATGGATCAAACCTACAGCCTTGAGCCTGATAGTCAA

CTATTCCACTACTGAGCTACATCCCATCCCGTAAGTCTCTTGTAGTACTTATGTACCTCAGCTCTGCTCCTGTGTGTTCACAATTAGTGGACATTTGGCC

TCACGATATGACGGTTATATTCTGTAGACCATCTGTTCCTACCCCTGCACTTCTGAGACAGGGCCCAGGTTGGTCTGGAACTCATGGCAGTATTCCTGCC

TCAGCCTCCTGGGTGCTGAGATCACAGGCATGAATCACCATGCCTGGCTTTGCTTCAGTTTTATCTCTGAACAAGGAAAGGACTACCACTGTCCCAAAGC

TTCACTCGATGCTTCCTGAAGCCAAAGCCACGTTTGCTCCCCACAGAACTTAACACTGTGCCTTCCTGTCTGTGGGTGGATTTTTACTTCACATTTATCT

TTGATCTTACATTTATTGGTAGTATCTTATACTTGTCTAAAAGGAAGATATCTACAGCTAGGGGTGTGATGTTTATTGTTTAAAAAAAAAAAGGTTACAT

GTCTGTATATTTCGAGTATATTTTTGTAGAGATATACATCCATAGATACACATGGTATAAGCTGGTCTGGGAATTCACCCCAGAGTCTGGTGCATGCTAA

GCATGCCCAGCTACTTTGAACTTCTTAAGGTATACTTGAAACTTTCATCCACAGTTTTATATGTTAGACTGCAGCTAACTAGCCTTGTGTTGTGCCCAAC

ACTTTGGTGCTATAGAAGAAACCTCATAAGTAGCCTCTTCATTAAGCAAACACCTATCTATACCAGGGACCAGTTTCTTTGTGTTGTGTGTGTGTGTTCT

TTTGTTTTGTCTTTTAAGGTTTTTTGTTTGTTTGTTTTATTTTTTTTGAGAGAGTGTCTCACTATGTAGCTCTGACTATCCTGGAACTAGAGATCTGCCT

GCCTCTGCCTCCCAAGTGCTGGTATTAAAGGTCTCCTCCCGGAGCTACTGGGCCTGGATTTGGGGACTGGTTATCAAGGTAAACTACAGCTCAAGAGGCT

GGCAAGACTTTTTCAGTTCATAGAAATAATTGCTATGCCTCAGAGTCCTCCAACTTTGAGTCTACGGTCACCAAAACTAGTCTAAAGAAGGCTCGGATCA

GCTCGAAGGAGTCTGGATCCCTTTGGGAAGCTTCGATTGTGCTTTTTCGAGTCAGGGCAAGAAGCTTCAGGCATACCCTGAACCTTTAAGATTCTCCTGA

TTGGGAATCCAAAGCCTGAAAGAGGCTTCACAATTAGGTAATTCTGAAGTCCTGTTCTTCTATTCTTACAGCCTCTTTGCCCTTTGCATTTTTTCCCCAC

GTCTAGATAGCTATGGGGATTGCTTAGGAAAAACTGATGTAGGAGCTCACATGGTTCATGGGTGGGGTGGCACGGTGCTTGTATAGTGAGCATAGTGCCC

TAGGTTTGTCCCCAGAGGTACAAGTCAGAAAGAAACGATCAAGAACCACACTCAGAGTGGCTGTTCCATTTTATGTTTCTGCCCTCCATTCCTGTGTGAG

TGGTCCAGTCTCTCCATGTTCTCTCACCAGCATTCAGTGATGTTAAATACTATTTCATGTGCTTTCTGCCATCTGCTTGCCCTCATCTTTTACATCTTTG

TTCTTGTCTTTGTCAGTTTGTCAATTAGATTGTTTACTAAACGAGCCATATCTTTTAGTAAAGTTTTAAAAATAATATCTGACTTCAGAAGTCAGGAAAT

AGGACTTTTCAAATCATTTAAGTCAGAATTTTAAAGCATCTTGAACATTGTCTTACAGTGTGCCCAACAGAAGGGCATTTACTTCTGGGCTCATTACACA

GTGTGAGGCTCATGCTGTGAAAAGAACAAAAACAAGGTTTCTACGGCAACTTTACTTAAGATTTCCTGTAGTGTGTCCGGAGACATACTTTATATATAGC

AATTATCATGTTTCTAACTGTGCAATGGTATGATTTATGTAAAGATTCAAAATGATTTTGTGGAAAATTAATTAGCAAAGATGGATAAGTGTAGATTTGA

ATTCTTATGTATCAGTAATTTATGATCTTATTTCTCTGTTATTGTGAATGTTGGTTTTATTAAAGAGTTATTGAAACTGTCATAAACCATTTTATAGGTC

TTTAATAAAATTAAAGATGAAATCAGCAATAGAAATACTTTTCATATGCATATT
Translation
MSGQQERAERQREELSASASPPSRFVLGLDVGSTVIRCHVYDQTARVRGSSAQK - UNI23867 - VENVYPQPGWVEIDPDSLWAQFVAVIKDAVKA

 AAGVQMNQIVGLGISTQRATFITWNK KKTGHHFHNFISWQDLRAAELVKSWNNSLIMK - UNI20076 - LLHGATRVLHFFSRSKVMLTVSRFNF

STQHATLRLTWILQNLSE - UNI31228 - VKRAVEEDNCCFGTIDTWLLYKLTKG GSSYATDYSNASTTGFFDPYA MRWSRLITTMVSIPLSILP

PVKDTS SYNFGSVDEKIFGVPIPVVAL VGDQQSAMFGECCFETGDVKLTMGTGTFLDINTGKNLQHVNGG GFYPLIGWKIGQELVCLAEGNAGDTGT

AIMWAQKLD - UNI5014 - DLFTDAAETEKMALSLEDSEGVYFVPSFSGLQ - UNI19706 - APLNDPCACASFMGLKHSTNKYHLVRAILESI

AFR RNKQLYDMLQREIQIPVTNIR RADGGVCNNAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVG GFWADKEELQKLRQSEMVFKPQKKWQE

YE AF

For any suggestions or comments, please send an email to unitrap@crg.es