Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041444 (Grit)
Chromosomal location
Chr 9: 32015785 - 32068869 (+)
Description
Rho GTPase-activating protein Gene [Source:MGI Symbol;Acc:MGI:2450166]
RefSeq_dna
NM_177379 
RefSeq_peptide
NP_796353.1 
UniGene
Mm.46683 
MGI
MGI:2450166 
Uniprot/SWISSPROT
Q811P8 
Uniprot/SPTREMBL
Q3US80 
Human Ortholog
ENSG00000134909 (AP000751.4)
Omim not available
UniTrap UNI5466
Vector Insertion
Chr 9: 32015851 - 32046846
Public Clones XG754 (baygenomics) CSJ270 (baygenomics) (ggtc) A058A04 (ggtc)
A058F01 (ggtc) A051C04 (ggtc)
Private Clones OST423401 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18692
Vector Insertion
Chr 9: 32046997 - 32052736
Public Clones not available
Private Clones OST417545 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4451
Vector Insertion
Chr 9: 32056161 - 32058226
Public Clones AC0062 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6248
Vector Insertion
Chr 9: 32058373 - 32061651
Public Clones CSD021 (baygenomics) IST12843H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9745
Vector Insertion
Chr 9: 32061724 - 32062758
Public Clones XG279 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047637
Sequence
GTCATTGTGTCGAGTTAATTAACCAGAAAGTTCCTCAGTCAGTAACCAACTCAGTGCCAAAACCAG - UNI5466 - TGTCTAAAAAGCACGGCAAGC

TCATTACTTTCTTGCGAACATTCATGAAGTCTCGCCCAACAAAACAGAAGCTAAAGCAGCGGGGCATCTTGAAAGAGAGAGTATTCGGTTGTGACTTGGG

GGAGCACCTCCTCAATTCTGGGTTTGAAG - UNI18692 - TGCCCCAGGTTCTTCAGAGCTGCACAGCGTTCATCGAGAGGTATGGCATTGTGGATG

GGATATATCGTCTCTCTGGCGTTGCCTCCAATATCCAGAGACTTCG TCATGAATTTGATTCTGAGCATGTCCCCGACCTGACAAAAGAACCTTATGTTC

AAGACATCCATTCTGTGGGCTCCCTCTGTAAGCTGTACTTCCGAGAACTCCCAAACCCTCTGCTCACCTACCAGCTATACGAGAAGTTCTCT GATGCTG

TTTCAGCAGCAACGGATGAAGAACGGTTGATAAAAATCCATGATGTCATCCAGCAACTCCCCCCACCACACTATAG AACCCTGGAGTTCCTGATGAGAC

ACCTGTCTCTTCTAGCAGACTATTGCTCCATCACAAATATGCATGCGAAAAACCTTGCCATTGTGTGGGCACCAAACCTGCTGAG ATCAAAGCAGATAG

AGTCAGCTTGCTTCAGTGGGACAGCAGCTTTCATGGAAGTGAGGATTCAGTCTGTGGTTGTTGAATTCATTCTCAATCATGTGGATGTGCTCTTCAGTGG

CAAAATCAGCGCTGTCATGCAGGAAGGAGCAG CTTCTCTGTCAAGGCCCAAGTCCCTGCTGGTCTCGTCTCCATCTACCAAGCTGCTGACATTGGAGGA

AGCCCAGGCAAGGACGCAGGCTCAGGTCAGTTCTCCTATTGTGACGGAAAATAAGTACATCGAAGTCGGAGAAGGGCCTGCTGCGCTGCAAGGGAAGTTT

CACACCGTCATTGAGTTCCCACTTGAAAG - UNI4451 - AAAGAGGCCTCAGAATAAGATGAAAAAATCTCCCGTTGGCAGCTGGCGTTCCTTTTTC

AATTTGGGGAAGTCCTCTTCTGTCTCCAAACGCAAGTTGCAGCGTAATGAAAGTGAGCCCTCAGAAATGAAAGCCATGGCTTTGAAAG - UNI6248 -

 GTGGCAGGGCAGAAGGAACCCTCCGCTCAGCTAAAAGTGAAGAGTCCCTTACTTCTCTCCATGCAGTTGACG - UNI9745 - GTGATTCCAAGTTG

TTCCGACCTAGAAGACCCAGATCCAGCAGCGATGCGCTCTCTGCCTCTTTCAATGGCGACGTGCTGGGGAACCGGTGCAATTCCTATGACAATCTGCCCC

ACGACAACGAGAGTGAAGAGGAAGTGGGGCTGCTCCACATTCCAGCTCTTGTGTCTCCTCATTCGGCTGAGGATGTTGACTTGAGTCCACCAGACATCGG

AGTGGCCAGTCTGGACTTTGATCCCATGTCATTTCAATGTAGTCCTCCAAAAGCTGAGTCAGAGTGTCTGGAGAGTGGTGCTTCCTTTCTGGATTCATTA

GGTTATACCAGGGATAAACTGAGTCCCAGTAAGAAGGATGCAGAAGCAGGTGGTAGCCAGTCACAGACTCCAGGAAGCACCGCAAGTTCCGAACCTGTAT

CTCCAGTCCAGGAGAAACTGAGTCCGTTTTTCACCCTGGACTTGAGCCCCACTGACGACAAGTCTTCTAAGCCATCTTCATTTACAGAAAAGGTTGTTTA

TGCTTTCTCTCCGAAGATTGGGCGGAAGCTAAGCAAATCTCCTTCCATGAACATATCTGAGCCTATTTCAGTGACTCTCCCACCTCGGGTATCAGAAGTC

ATCGGTACGGTCTCCAATACTGTAGCTCAGAATGCATCACCTACATCTTGGGACAAAAGTGTGGAAGAAAGAGATGTCATAAATAGATCCCCCACCCAGC

TGCAGCTAGGAAAGATGAAAGCAGGTGAGAGAGAGGCACAGGAGACCTGTGAACCAGAAGCACAGCCCCTGGAACAGGGGGCAGCTGAAGAAGTAGAGTT

GCCAGGGACAGAGGAGCGGCCTGTCCTGAGCAGTCAGAGCAAGGCTGTACCGTCTGGACAGAGTCAGACAG GAGCAGTTACCCATGACCCCCCTCAGGA

TCCCGTTCCTGTCAGTTCAGTCTCTCTTATCCCACCACCACCGCCTCCGAAAAATGTCGCCCGAATGTTGGCACTAGCGTTAGCTGAGTCTGCACAGCAA

GCCTCAAGTCAGACACTGAAGAGACCAGGGGCTTCCCAGGCTGGGTGCACTAGTTATGGAGACACGGCAGTCGTTCCATCTGAAGAGAAGCTGCCTAGTT

CCTACTCTAGCCTTACTCTAGATAAAACCTGTTTCCAAACGGACCGGCCAGCAGAGCAGTTCCACCCGCAGATCAATGGACTCGGAAACTGTAACCAGCC

TCTCCCTGAGGCAGCAGCTATGGGAGGTCCCACCCAGTCCAACACAACTGACTCTGGGGAGCAACTCCACCAAGTAGACTTAATAGGGAATTCGCTACAT

CGAAACCATATATCTGGGGATCCAGAAAAGGCTAGAAGCACTTCAGCTCCCTTAACAGACTCAGAGAAGTCTGATGATCATGGAAGTTTCCCTGAAGACC

ACGCTGGGAAGAGCAGCGTGTCCACTGTCTCCTTTTTGGAGCAGGACCAGTCTCCACTCCATTTCTCCTGTGGAGATCAGCCCCTCTCTTACCTTGGTAC

CAGTGTGGATAAACCCCACCATTCCTCAGAACTTACAGACAAATCTCCCATGCCTTCTACTTTGCCTAGGGACAAAGCCCACCACCCTCTCTCTGGGTCC

CCTGAAGAGAATTCCAGCACAGCCACCATGGCTTACATGATGGCAACTCCAGCAAGAGCGGAACCGAGCAACAGCGAGGCCAGCAGGGTCCTGGCTGAGC

AGCCCTCGGCTGCTGATTTTGTGGCTGCCACCCTTCAGCGCACGCACAGAACTAATCGGCCCCTCCCTCCACCTCCTTCCCAGAGGCCTGCAGAGCAGCC

ACCAGTTGTGGGGCAGGTACAAGAAGCACCAAGTATAGGATTAAATAATTCCCACAAG GTCCAGGGAACGGCTCCAGCTCCCGAGAGGCCACCTGAGTC

TCGGGCCATGGGTGACCCCGCACCCATCTTCCTCAGTGATGGCACTGCTGCTGCCCAGTGTCCCATGGGCGCCTCTGCTCCTCAGCCTGGACTGCCTGAG

AAGGTTCGGGAAAGCAGCAGGGCTCCACCACTCCACTTACGTGCTGAGTCTTTTCCTGGCCATTCCTGTGGCTTTGCTGCCCCAGTTCCCCCAACACGGA

CAATGGAGAGCAAGATGGCTGCTGCCTTGCACTCCAGCGCTGCAGATGCCACCAGCAGTTCAAATTACCACTCCTTTGTCCCTTCGTCAGCCTCAGTGGA

TGATGTGATGCCCGTGCCACTCCCCGTCTCACAGCCTAAGCATGCTTCTCAGAAGATAGCCTATTCCTCCTTTGCTAGGCCTGATGTCACCGCAGAGCCC

TTTGGTCCAGAAAACTGTTTGCATTTCAATATGACTCCAAACTGCCAGTTTCGCCCCCAGAGTGTTCCTCCACACCACAATAAGTTGGAGCCACATCAGG

TATATGGTGCCCGGTCAGAGCCACCAGCCTCCATGGGTCCTCGTTATAACACCTATGTGGCGCCGGGAAGAAACATGTCTGGACACCACTCCAAGCCGTG

TAGTCGGGTTGAGTATGTCTCTTCTCTGGGCTCCTCGGTTAGGAATCCTTGTTGCCCTGAAGACATTCTACCTTACCCTACCATCCGGAGGGTACAGTCC

CTCCATGCACCCCCACCTTCCATGATCCGCTCTGTTCCCATTTCACGGACAGAAGTTCCCCCAGATGATGAACCAGCCTACTGCCCAAGACCAGTCTACC

AGTATAAGCCATACCAGTCCTCCCAGGCCCGCTCAGACTATCACGTAACTCAGCTTCAGCCTTACTTTGAGAATGGACGGGTCCATTATCGCTATAGTCC

GTACTCCAGCTCCTCCAGCTCCTATTACAGTCCTGAGGGGGCCTTGTGTGATGTCGATGCCTATGGCACAGTCCAGCTGCGGCCCCTCCACCGCCTGTCC

AGTCGGGACTTTGCTTTCTACAATCCAAGGCTACAAGGAAAGAACGTGTACAACTATGCTGGTTTGCCTCCACGCCCACGGGCCAATGCAACTGGCTATT

TCTCTGGTAATGACCATAATGTAGTCACTATGCCCCCCACTGCTGACGGAAAGCACACCTACACCTCATGGGACCTTGAGGACATGGAAAAATACCGCAT

GCAGTCCATCCGCCGAGAGAGCCGAGCACGGCAGAAGGTAAAAGGGCCTATCATGTCGCAGTATGACAACATGACACCAGCTGTGCAAGAAGACTTGGGA

GGGATCTATGTCATCCATCTGCGCAGCAAATCAGATCCTGGGAAAACTGGACTTCTCTCTGTGGCAGAGGGGAAAGAGGGACGGCACCCAGCCAAGGCTG

TCAGTCCTGAGGGGGACGAGCGTTTCTACAGGAAGCACCCAGAGTCCGAATTTGACAGAGCCCACCATCATGGAGGGTATGGCAGCACACAGGCAGAAAA

GCCATCCCTCCCGCAGAAGCAAAGCAGCCTTAGGAACAGAAAGCTTCACGATATGGGTTGTAGCCTCCCAGAGCACAGGGCGCATCAGGAAGCAAGCCAT

AGGCAATTATGTGAATCAAAAAATGGACCACCTTATCCCCAGGGAGCTGGCCAGTTAGATTATGGGTCCAAAGGGATGCCAGACACTTCTGAGCCAAGCA

ACTACCATAACTCTGGGAAATATATGACATCAGGGCAGGGGTCTCTAACCCTGAACCACAAGGAAGTGAGGCTTCCCAAAGATCTGGACAGACCTCGAGC

CAGGCAGCCACCTGGCCCTGAGAAACACTCCAGAGACTGCTACAAGGAGGAGGAACACTTCTCTCAGTCTATGGTCCCACCCCCCAAACCAGAGAGGAGT

CACAGCCTAAAACTTCACCATACCCAGAACCTGGAGAGGGACCCCAGCGTGCTATACCAGTATCAGACACACAGCAAGCGCCAGAGCAGCATGACTGTTG

TGTCCCAGTATGATAACCTGGAGGATTACCACTCCCTGCCCCAGCACCAGCGAGGAGGCTTTGGAGGGGCGGGCATGGGGGCCTATGTGCCCTCTGGCTT

TGTCCATCCACAGAGCAGGACATACGCCACAGCATTGGGTCAGGGGGCCTTCCTGCCCACAGAGTTGTCCTTGCCACATCCCGACACGCAGATCCATGCA

GAATGAGCCCCGGGAGCAATAGAGTTGAAGCAGCCTCTGCTGGACAGTGGACTGTTCTATTTTTTTTCCAATAACCAAAAAGATTTAAGAAAGAAAAAAA

AGCTACAAACCCCTTGGCCACATGAAAGAAGTATAATAAAAG
Translation
 - UNI5466 - MKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEV - UNI18692 - VPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLR R

HEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFS DAVSAATDEERLIKIHDVIQQLPPPHYR RTLEFLMRHLSLLADYCSITNM

HAKNLAIVWAPNLLR RSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLFSGKISAVMQEGAA ASLSRPKSLLVSSPSTKLLTLEEAQARTQAQVS

SPIVTENKYIEVGEGPAALQGKFHTVIEFPLER - UNI4451 - RKRPQNKMKKSPVGSWRSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKG - U

NI6248 - GGRAEGTLRSAKSEESLTSLHAVDG - UNI9745 - GDSKLFRPRRPRSSSDALSASFNGDVLGNRCNSYDNLPHDNESEEEVGLLHIP

ALVSPHSAEDVDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSLGYTRDKLSPSKKDAEAGGSQSQTPGSTASSEPVSPVQEKLSPFFTLDL

SPTDDKSSKPSSFTEKVVYAFSPKIGRKLSKSPSMNISEPISVTLPPRVSEVIGTVSNTVAQNASPTSWDKSVEERDVINRSPTQLQLGKMKAGEREAQE

TCEPEAQPLEQGAAEEVELPGTEERPVLSSQSKAVPSGQSQTG GAVTHDPPQDPVPVSSVSLIPPPPPPKNVARMLALALAESAQQASSQTLKRPGASQ

AGCTSYGDTAVVPSEEKLPSSYSSLTLDKTCFQTDRPAEQFHPQINGLGNCNQPLPEAAAMGGPTQSNTTDSGEQLHQVDLIGNSLHRNHISGDPEKARS

TSAPLTDSEKSDDHGSFPEDHAGKSSVSTVSFLEQDQSPLHFSCGDQPLSYLGTSVDKPHHSSELTDKSPMPSTLPRDKAHHPLSGSPEENSSTATMAYM

MATPARAEPSNSEASRVLAEQPSAADFVAATLQRTHRTNRPLPPPPSQRPAEQPPVVGQVQEAPSIGLNNSHK VQGTAPAPERPPESRAMGDPAPIFLS

DGTAAAQCPMGASAPQPGLPEKVRESSRAPPLHLRAESFPGHSCGFAAPVPPTRTMESKMAAALHSSAADATSSSNYHSFVPSSASVDDVMPVPLPVSQP

KHASQKIAYSSFARPDVTAEPFGPENCLHFNMTPNCQFRPQSVPPHHNKLEPHQVYGARSEPPASMGPRYNTYVAPGRNMSGHHSKPCSRVEYVSSLGSS

VRNPCCPEDILPYPTIRRVQSLHAPPPSMIRSVPISRTEVPPDDEPAYCPRPVYQYKPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPE

GALCDVDAYGTVQLRPLHRLSSRDFAFYNPRLQGKNVYNYAGLPPRPRANATGYFSGNDHNVVTMPPTADGKHTYTSWDLEDMEKYRMQSIRRESRARQK

VKGPIMSQYDNMTPAVQEDLGGIYVIHLRSKSDPGKTGLLSVAEGKEGRHPAKAVSPEGDERFYRKHPESEFDRAHHHGGYGSTQAEKPSLPQKQSSLRN

RKLHDMGCSLPEHRAHQEASHRQLCESKNGPPYPQGAGQLDYGSKGMPDTSEPSNYHNSGKYMTSGQGSLTLNHKEVRLPKDLDRPRARQPPGPEKHSRD

CYKEEEHFSQSMVPPPKPERSHSLKLHHTQNLERDPSVLYQYQTHSKRQSSMTVVSQYDNLEDYHSLPQHQRGGFGGAGMGAYVPSGFVHPQSRTYATAL

GQGAFLPTELSLPHPDTQIHAE

For any suggestions or comments, please send an email to unitrap@crg.es