Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041445 (Mmrn2)
Chromosomal location
Chr 14: 35188690 - 35217473 (+)
Description
multimerin 2 Gene [Source:MGI Symbol;Acc:MGI:2385618]
RefSeq_dna
NM_153127 
RefSeq_peptide
NP_694767.3 
UniGene
Mm.272673 
MGI
MGI:2385618 
Uniprot/SPTREMBL
A6H6E2 Q8BJX4 
Human Ortholog
ENSG00000173269 (MMRN2)
Omim not available
UniTrap UNI21830
Vector Insertion
Chr 14: 35188965 - 35209350
Public Clones D168B05 (ggtc) IST11656A3 (tigm) IST12565G6 (tigm) IST12835D2 (tigm)
Private Clones OST316360 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20944
Vector Insertion
Chr 14: 35212810 - 35216098
Public Clones not available
Private Clones OST347689 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111908
Sequence
TTTGTTGTCCTCGTGTTTTCTTTTCTTTCTGACATTTCGCTTGAAGACCACATCACCAGCAAATTTGAGAGTCACTTGTAAGGCTGAGCATCAGCACAGG

AGCCCCTCACCATGATCCCGACACTGCTGCTGGGCTTTGGGGTGTACCTGAGCTGGGGACTGCTAGGGTCCTGGGCACAGGACCCCGGTACCAAGTTCTC

CCATCTCAATAGGCCCGGCATGCCTGAAGGCTGGAGACTAGGGGCTGAGGATACCAGCAGAGACCCCATCAGACG - UNI21830 - GAACTGGTGTC

CTTACCAGAAGTCCAGGCTAGTCACCTTTGTAGCTGCTTGCAAAACAGAGAAATTCCTGGTCCATTCACAGCAGCCATGTCCACAGGGAGCCCCTGACTG

CCAGGGAGTCAGAGTCAT GTATCGAGTGGCCCAGAAGCCAGTGTACCAGGTCCAGCAGAAGGTGCTGATCTCTGTGGACTGGCGGTGCTGCCCAGGGTT

CCAGGGACCAGACTGCCAGGACCACA ATCCCACAGCAAACCCTGAGCCCACAGAGCCAAGTGGTAAACTCCAGGAGACTTGGGACTCGATGGATGGCTT

TGAACTTG GTCACCCTGTCCCAGAGTTTAATGAGATTAAGGTGCCACAAGAACAACAGGAAAACCTGCTTCAAAATCTCCAGAATGATGCCCAGTCAGT

AGAAGATGGCTTTCCAGGCTCTTGGGAAGCCCCACCCAGCAACCTCACAGATGAGATGACAGAAGCCAATCTAACAGAATTCG AGTTTCCTGGCAGGAC

ATCAGAGCACCTGCTGCAGCCCCATATTGATGCATTCCTGAAAGCACACTTCAGTCCCATCTGGAAGAACTTCAACGACAGCTTGCACAGCCTCTCCCAG

GCCATCAGAAACTTGTCTCTTGATGTGGAGGCCAATCACCAGGCCATCAAGATGATCCAGGAGGGCACAGTGGCTAGGGCTGACTTCCAAGAGCTTGGTG

CCAAGTTTGAGGCCAAGGTCCAGCAGAATAGCCAGAGACTGGGCCAACTGTGGCAGGATGTGGAGGACCAGCTGCATGCCCAGCGCCGATCGGTGCATCA

TGCCCTCTCTGATGTCCAGGCTGAGGTGAGCACCAAGTTAAAGCAGCTTGTCAAGGCTCAGGAACTTCCAGGGGCCAATGGCAGCCTGGTGATGGCATCT

GCAGCAGCGGCAGCAAGGCCAGAGCCAGAGAGCCTGCAGGCCAGGCTAGGGCAGCTGCAGAGAAACCTCTCTGCTCTGCACATGGTCACTAGCCAGAGGG

AGGAGGAGTTGCAGAGCACCCTCAAGAACATGGACAGCGTCCTGAAGCAGCACGCCGAAGAGATCAAAGAGCTCTATTCTGAATCGGATGAGACCTTCGA

CCAGATCAGCAAGGTAGAGAGGCAGGTGGAGGAGCTGCTGGTGAACCACACCGGGCTTCGAGAGCTGCGGGTGATCCTAATGGAAAAGTCCCTGATCATG

GAGGAGAACAAAGAGGAGATAGAGCGGCAACTGTTGGAACTCAACCTTACCCTGCAGCATCTGCATGCGGGTCATGCAGACCTCATTAAGTATGTCAAGG

ACTGCAACTGCCAAAGGGTCAACTCTGACGTGGATGTCGCTCCGGAGGGCCACAGGGATGTCATGCACACCCTAGAAGAGACCCAAGTGAGCCTGGACGA

ACAGCACCAGCTAGACGGTTCTTCTTTGCAGGCCCTGCAAAGCACTGTAGATGCCATGTCTTCAGCAATGGATGCCTATAGAGGAGAGGGTGAACGGGCC

CGGGCTGAAAGGGCACGGATACGGAGCCAACTGCGGGCTCTGGATCATGCTGTGGAAGCGCTGAAGACAGCGGCGAATGGAACCCGCAAAGAGATACGCC

TACTGCACGGCTCCTTCACAGCCCTGCTGGAGGATGCCCTGCGACATCAGGCCGTGCTAGCTGCACTCTTCGGGGAGGAGATGATAGACGAGATGTCAGA

GGAGGCCCCTCGCCCTCTGCCACTGGATTATGAGCAGATCCGCCTAGCCCTGCAGGACGCGGCCAGTGGGCTACAGGAACAGGCGATTGGTTGGGAGGAC

TTGGCCACCCGGGTGGAGGCATTGGAGAAGGCCGCAGGTGGCTTTGTGGAGCAGCACCCACAGTTGGCAGAGGGACTTGAGCCCAGCCACGACTCTGGGA

GAGAGGAGGAAGCCATGACTTTGGCGGAGCTGGAGCAGGAGATTCGGCGCCTGAGTTCTGATGTCAAGCAGATTGGGCAGTGCTGTGAGGCCTCCTGGGC

TGCCTCCCTCAATAGCTCCCTTGAAGACCTACACAGCATGCTCTTGGACACCCAGCACGGCCTGAGACAGCACCGGCAGCTCTTCCACAACCTCTTCCAG

AACTTCCAAGGTCTGGTGGCAAGCAACATCAGCCTAGACTTGGGGAAGCTGCAGGCCATGTTGAGTAAGAAAGATAAGAAGCAACCGAGAGGCCCAGGAG

AATCCCGGAAGAGGGATAAGAAGCAAGTGGTGATGTCTACAGATGCACACGCCAAAGGTCTGGAGCTCTGGGAGACAG - UNI20944 - GCTCCCCT

GTGGCCTTCTATGCCGGTTCTTCAGAAGGGGCCACTGCTCTGCAGATGGTGAAGTTCAACACCACATCCATCAATGTGGGCAGCAGCTACTTTCCTGAAC

ATGGCTACTTCCGAGCTCCCAAACGTGGCGTCTACTTGTTTGCTGTGAGCATTACATTTGGCCCAGGCCCAGGAATGGGGCAGCTGGTATTTGAAGGTCA

TCACCGGGTTCCAGTCTACAGTACGGAACAGAGGGGCGGGAGCACAGCCACCACTTTTGCTATGGTAGAGCTACAAAAGGGTGAGAGAGCGTGGTTTGAG

TTAATCCAAGGGTCAGCAACCAAAGGGAGCCAACCAGGCACTGCATTTGGGGGCTTCCTGATGTTCAAGACCTGAACCCTGGGCTCGGCTCAGCTTGTAT

CAGACATGGTAGATCCGCCTGCTGCTCTTAGACTGAGGCTCTGGCCAGCAAAGGCTGGAGAACATCTAGTGGCCTAGCTCTTCCCTGGACACCTTCTGCA

AAGACCCTGCGGCCAGCAGCACGTACCTTCTTCTGGACACACAGGTTGGGGAGGCCAGAATACTGCTCTCTGGACTGGGCCGGGGCCTGGAGTGGGAGCT

GGGATTTCCATGCCTTCCCCAATGGCACGGCTCGGCTTGTCTCTGAGACACTTCCTCAGTTCTACAGCTTTTCTTTTTCTCTCCCTTGTGGTTGGAAACT

TGTACACTTACGCCTTTTTCGGTTTCCACTTTTCTGTGTTAGAAAGTCACTGTTTCTCAGAAGGAATGTCTACAGTGATGGGTTTGCCATGCAGAAAGGT

CCCAGATTCTCTTTCCAATGTCTCAAAAAAAAAAAAAAAAAAAAAAAAAAGAAGAAGAAGAAGAAAATGAAGATTTTTTTTTTACCCCCCCCCCCCCCAT

GAAACTGGAAACAGGTCTCCAATTACTACAGAAAAGCTAATCAAAAACAGTCTTTCTAGTTTCAGAAGGGAGCCAACACATGGTTGAATTAGCCCTGGGT

CCAGTCTCCAGCACTGTGCACACCTATGGTCTCAGCATATGGAGTAAGCATGAAGTTCAGAGCTATCCTCAGCTTCATAACAAGTTCAAGGCTAGCCTGG

GATATGGGAGACCCTGTCTCAAAACAGCAAAAGAAGTTACATTAACTCCCAGCCACACTTTGTCTTTGTTTATTTAATTTTAATATCACGCCCTGCTTCA

CTCTGTAAAGGCCAACATATCAAATAGGGACAATGTTGTGCATGGCCTTCACCCTTCTTATTCATCTATCAAGACTGTGCCAACCCCAGCATCTCTAAGG

AAGGGAAGGAGGGAAATTAAACCCTACTGGTAGTGACCGACTTTGGAATAAAGTGATACTCTCCAAA
Translation
MIPTLLLGFGVYLSWGLLGSWAQDPGTKFSHLNRPGMPEGWRLGAEDTSRDPIRR - UNI21830 - RNWCPYQKSRLVTFVAACKTEKFLVHSQQPC

PQGAPDCQGVRVM MYRVAQKPVYQVQQKVLISVDWRCCPGFQGPDCQDHN NPTANPEPTEPSGKLQETWDSMDGFELG GHPVPEFNEIKVPQEQQEN

LLQNLQNDAQSVEDGFPGSWEAPPSNLTDEMTEANLTEFE EFPGRTSEHLLQPHIDAFLKAHFSPIWKNFNDSLHSLSQAIRNLSLDVEANHQAIKMIQ

EGTVARADFQELGAKFEAKVQQNSQRLGQLWQDVEDQLHAQRRSVHHALSDVQAEVSTKLKQLVKAQELPGANGSLVMASAAAAARPEPESLQARLGQLQ

RNLSALHMVTSQREEELQSTLKNMDSVLKQHAEEIKELYSESDETFDQISKVERQVEELLVNHTGLRELRVILMEKSLIMEENKEEIERQLLELNLTLQH

LHAGHADLIKYVKDCNCQRVNSDVDVAPEGHRDVMHTLEETQVSLDEQHQLDGSSLQALQSTVDAMSSAMDAYRGEGERARAERARIRSQLRALDHAVEA

LKTAANGTRKEIRLLHGSFTALLEDALRHQAVLAALFGEEMIDEMSEEAPRPLPLDYEQIRLALQDAASGLQEQAIGWEDLATRVEALEKAAGGFVEQHP

QLAEGLEPSHDSGREEEAMTLAELEQEIRRLSSDVKQIGQCCEASWAASLNSSLEDLHSMLLDTQHGLRQHRQLFHNLFQNFQGLVASNISLDLGKLQAM

LSKKDKKQPRGPGESRKRDKKQVVMSTDAHAKGLELWETG - UNI20944 - GSPVAFYAGSSEGATALQMVKFNTTSINVGSSYFPEHGYFRAPKRG

VYLFAVSITFGPGPGMGQLVFEGHHRVPVYSTEQRGGSTATTFAMVELQKGERAWFELIQGSATKGSQPGTAFGGFLMFKT

For any suggestions or comments, please send an email to unitrap@crg.es