Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041477 (Dcp1b)
Chromosomal location
Chr 6: 119125271 - 119170224 (+)
Description
DCP1 decapping enzyme homolog b (S. cerevisiae) Gene [Source:MGI (curated);Acc:Dcp1b-001]
RefSeq_dna
NM_001033379 
RefSeq_peptide
NP_001028551.1 
MGI
MGI:2442404 
Uniprot/SWISSPROT
Q3U564 
Uniprot/SPTREMBL
B2RUI2 
Human Ortholog
ENSG00000151065 (DCP1B)
Omim not available
UniTrap UNI3563
Vector Insertion
Chr 6: 119125270 - 119125461
Public Clones AY0868 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073909
Sequence
GGAAGATGGCGGCCGCGGCGGCAGGTGGCCTGCCTGGGAAGGGACACGATATCAGCCTGGCAGCCCTGCGGCGCCACGACCCCTACATCAGTCGCATCGT

GGACGTGGCCAGCCAGGTGGCTCTGTACACTTTCGGCCATCGGGCCAACGAGTGG - UNI3563 - GAGAAGACTGGAGTGGAGGGAACCTTGTTTGT

TTATACGAG GTCTGCCTCCCCAAAGCACGGATTCACCATTATGAATAGGCTCAGCATGGAAAACAGAACAGAACCCATTACTAAAGACCTGGACTTCCA

GCTCCAGAACCCTTTCCTTCTCTACAGAAACGGCACAC TGTCCATTTATGGAATTTGGTTTTATGATAAGGAAGAGTGCCAGAGAATTGCAAAACTAAT

GAAAAA CCTCACTCAGAGCGAACAGTTGAAAGCCTGTCATGGAGCCGGATCCTCCCCCGTGACCTTGAGCTCAGGAGAGGGCCAAGAAGTAGATATCCT

GCAGATGCTCACCAAGGCCAAGGATGAGTACACCAAG TGTAAGACCTGTTCCGAGCCAAAACAGATGACCAATTCCTCTGCCATCTGTGACAACCCTAA

ACTTATCAAACCTGTCCCCGTGAGACCCAGCAGCAGCCAGAGGCTGCAAGGACCTGCGCCCAGCAAG ACCTCGGACCCTGAGCCTCAGCACTTATCTTT

AACAGCACTATTTGGGAAACAAGACAAAGCTCCCTGTCAGGAAACTGTAAAGCCCTCCCGGACCTTTGCCCACCACCACCACCATCACCACCAGCAGCAG

CAAGAGACGCGTCCAGTTCATCACGGGGTCGCATGCTCCCTGTCCTGTGAGGAGCCCAGGAAGCTCTCACTCCCGGTGGAGAAGCAGCTCTGCCCGGCCA

TTCAGAAACTCATGCTCGGGAGCCCGGGGCTGCACCCCCTGCCTCAGCACCCTGAACAGTGGTCCTGCAAAAGTGGCAGCCCCAGTCCTGCCGGGGGAAT

TCTCCCTGGTCCTGTCCAGCTGGGGTCCCCCTGGAATGGCAGGGTTGCACACTGCACACAGAGCACTTGCAGAGGCCACAAGCTATTAGAGCAGCTTCAA

GGTGCCCCTGGGGCAGTGCATAAGTATAACCCCTGTGCGCCTACCGGTCCAGCTGTGGCCACTCAGGTGGCTCCGGGCCAGAGTGTGGCCCAATCACAGC

TGGTGTATTTCAGTGGCCCCCTTCAACCTCCCGCCCCAGGACACCAAGCTCTCAGGAAGGAGCAGGGTGCACTGCCTGCACAAGCGGTGTCCCTCTCTGG

CAGCCAGGAGAGCAGCCCCACCGTGCTCCCTACGCAGGAGCTGCTAAGGAAGCTCCAGGTAGTACACCAGGAGCAGCAGGCGGCCCCCCGGCCAGCCTTG

GCAGCCAGGTTCCCTGTGTCAGCCCAGGGATCAGGGACAGAAAAGCCCTTGGAAGCCTGGGTCAGCAAGACAGCCAGCATGGAGAAGCAGGCTCCTCTTC

TGCAG AACTGGGAGTCCTCCACCGTGGCCAGCAGGCCCCTCACCAGGCTGCAGCTCCAGGAGGCACTGCTGAACCTCATCCAG AATGATGACAACTTC

TTAAGCATAATCTATGAAGCCTATCTCTTCAGCGTGACACAAGCAGCCATGAGAACCACGTAACCAGCTACATGAGAGCAAAGACTAAGAATTGATCTTC

CAGGTTCTTCATGTGAACTGGTGTGACCAAACACACTTATGCCTTTTTAACAAAGTATAGTGATACAG
Translation
MAAAAAGGLPGKGHDISLAALRRHDPYISRIVDVASQVALYTFGHRANEW - UNI3563 - EKTGVEGTLFVYTR RSASPKHGFTIMNRLSMENRTE

PITKDLDFQLQNPFLLYRNGTL LSIYGIWFYDKEECQRIAKLMKN NLTQSEQLKACHGAGSSPVTLSSGEGQEVDILQMLTKAKDEYTK CKTCSEPK

QMTNSSAICDNPKLIKPVPVRPSSSQRLQGPAPSK TSDPEPQHLSLTALFGKQDKAPCQETVKPSRTFAHHHHHHHQQQQETRPVHHGVACSLSCEEPR

KLSLPVEKQLCPAIQKLMLGSPGLHPLPQHPEQWSCKSGSPSPAGGILPGPVQLGSPWNGRVAHCTQSTCRGHKLLEQLQGAPGAVHKYNPCAPTGPAVA

TQVAPGQSVAQSQLVYFSGPLQPPAPGHQALRKEQGALPAQAVSLSGSQESSPTVLPTQELLRKLQVVHQEQQAAPRPALAARFPVSAQGSGTEKPLEAW

VSKTASMEKQAPLLQ NWESSTVASRPLTRLQLQEALLNLIQ NDDNFLSIIYEAYLFSVTQAAMRTT
Transcript ENSMUST00000112777
Sequence
GGGGGCTTCCTGAAGGCTGGGCAGGAGGGTGGGTGGGAAGATGGCGGCCGCGGCGGCAGGTGGCCTGCCTGGGAAGGGACACGATATCAGCCTGGCAGCC

CTGCGGCGCCACGACCCCTACATCAGTCGCATCGTGGACGTGGCCAGCCAGGTGGCTCTGTACACTTTCGGCCATCGGGCCAACGAGTGG - UNI3563

 - GAGAAGACTGGAGTGGAGGGAACCTTGTTTGTTTATACGAG GTCTGCCTCCCCAAAGCACGGATTCACCATTATGAATAGGCTCAGCATGGAAAAC

AGAACAGAACCCATTACTAAAGACCTGGACTTCCAGCTCCAGAACCCTTTCCTTCTCTACAGAAACGGCACAC TGTCCATTTATGGAATTTGGTTTTAT

GATAAGGAAGAGTGCCAGAGAATTGCAAAACTAATGAAAAA CCTCACTCAGAGCGAACAGTTGAAAGCCTGTCATGGAGCCGGATCCTCCCCCGTGACC

TTGAGCTCAGGAGAGGGCCAAGAAGTAGATATCCTGCAGATGCTCACCAAGGCCAAGGATGAGTACACCAAG TGTAAGACCTGTTCCGAGCCAAAACAG

ATGACCAATTCCTCTGCCATCTGTGACAACCCTAAACTTATCAAACCTGTCCCCGTGAGACCCAGCAGCAGCCAGAGGCTGCAAGGACCTGCGCCCAGCA

AG ACCTCGGACCCTGAGCCTCAGCACTTATCTTTAACAGCACTATTTGGGAAACAAGACAAAGCTCCCTGTCAGGAAACTGTAAAGCCCTCCCGGACCT

TTGCCCACCACCACCACCATCACCACCAGCAGCAGCAAGAGACGCGTCCAGTTCATCACGGGGTCGCATGCTCCCTGTCCTGTGAGGAGCCCAGGAAGCT

CTCACTCCCGGTGGAGAAGCAGCTCTGCCCGGCCATTCAGAAACTCATGCTCGGGAGCCCGGGGCTGCACCCCCTGCCTCAGCACCCTGAACAGTGGTCC

TGCAAAAGTGGCAGCCCCAGTCCTGCCGGGGGAATTCTCCCTGGTCCTGTCCAGCTGGGGTCCCCCTGGAATGGCAGGGTTGCACACTGCACACAGAGCA

CTTGCAGAGGCCACAAGCTATTAGAGCAGCTTCAAGGTGCCCCTGGGGCAGTGCATAAGTATAACCCCTGTGCGCCTACCGGTCCAGCTGTGGCCACTCA

GGTGGCTCCGGGCCAGAGTGTGGCCCAATCACAGCTGGTGTATTTCAGTGGCCCCCTTCAACCTCCCGCCCCAGGACACCAAGCTCTCAGGAAGGAGCAG

GGTGCACTGCCTGCACAAGCGGTGTCCCTCTCTGGCAGCCAGGAGAGCAGCCCCACCGTGCTCCCTACGCAGGAGCTGCTAAGGAAGCTCCAGGTAGTAC

ACCAGGAGCAGCAGGCGGCCCCCCGGCCAGCCTTGGCAGCCAGGTTCCCTGTGTCAGCCCAGGGATCAGGGACAGAAAAGCCCTTGGAAGCCTGGGTCAG

CAAGACAGCCAGCATGGAGAAGCAGGCTCCTCTTCTGCAG TCTACCTGTGCCCCACTGAGGGAGACTGATAATGGGCTCATGGCCCTAGGAGGCCAAGA

ACTTCCTGCTGCCTCCTCCAGCCTCCTCCTGCCCCTGCAGAACTGGGAGTCCTCCACCGTGGCCAGCAGGCCCCTCACCAGGCTGCAGCTCCAGGAGGCA

CTGCTGAACCTCATCCAG AATGATGACAACTTCTTAAGCATAATCTATGAAGCCTATCTCTTCAGCGTGACACAAGCAGCCATGAGAACCACGTAACCA

GCTACATGAGAGCAAAGACTAAGAATTGATCTTCCAGGTTCTTCATGTGAACTGGTGTGACCAAACACACTTATGCCTTTTTAACAAAGTATAGTGATAC

AGAGTAAAATGTTTTATACTGTC
Translation
MAAAAAGGLPGKGHDISLAALRRHDPYISRIVDVASQVALYTFGHRANEW - UNI3563 - EKTGVEGTLFVYTR RSASPKHGFTIMNRLSMENRTE

PITKDLDFQLQNPFLLYRNGTL LSIYGIWFYDKEECQRIAKLMKN NLTQSEQLKACHGAGSSPVTLSSGEGQEVDILQMLTKAKDEYTK CKTCSEPK

QMTNSSAICDNPKLIKPVPVRPSSSQRLQGPAPSK TSDPEPQHLSLTALFGKQDKAPCQETVKPSRTFAHHHHHHHQQQQETRPVHHGVACSLSCEEPR

KLSLPVEKQLCPAIQKLMLGSPGLHPLPQHPEQWSCKSGSPSPAGGILPGPVQLGSPWNGRVAHCTQSTCRGHKLLEQLQGAPGAVHKYNPCAPTGPAVA

TQVAPGQSVAQSQLVYFSGPLQPPAPGHQALRKEQGALPAQAVSLSGSQESSPTVLPTQELLRKLQVVHQEQQAAPRPALAARFPVSAQGSGTEKPLEAW

VSKTASMEKQAPLLQ STCAPLRETDNGLMALGGQELPAASSSLLLPLQNWESSTVASRPLTRLQLQEALLNLIQ NDDNFLSIIYEAYLFSVTQAAMRT

T

For any suggestions or comments, please send an email to unitrap@crg.es