Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041530 (Eif2c1)
Chromosomal location
Chr 4: 126112256 - 126145878 (-)
Description
eukaryotic translation initiation factor 2C, 1 Gene [Source:MGI (curated);Acc:Eif2c1-001]
RefSeq_dna
NM_153403 
RefSeq_peptide
NP_700452.1 
UniGene
Mm.30800 Mm.408591 Mm.471222 
MGI
MGI:2446630 
Uniprot/SWISSPROT
Q8CJG1 
Uniprot/SPTREMBL
A1L365 A2VDG1 Q8BJP2 Q8CGU0 
Human Ortholog
ENSG00000092847 (EIF2C1)
Omim not available
UniTrap UNI10652
Vector Insertion
Chr 4: 126141100 - 126145640
Public Clones (sanger) W143E07 (ggtc) E061D12 (ggtc) D067A08 (ggtc) P009B11 (ggtc)
E056C08 (ggtc) D138A11 (ggtc) IST13657D1 (tigm) IST14823A2 (tigm)
IST10888C4 (tigm) IST14579G8 (tigm) IST10835G4 (tigm) IST14353G12 (tigm)
IST14587E4 (tigm) IST10118B5 (tigm) IST14469H12 (tigm) IST14117F11 (tigm)
IST10986B9 (tigm) IST12033H7 (tigm)
Private Clones OST422990 (lexicon) OST376097 (lexicon) OST333737 (lexicon) OST288054 (lexicon)
OST268886 (lexicon) OST240870 (lexicon) OST204316 (lexicon) OST119391 (lexicon)
OST113736 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10430
Vector Insertion
Chr 4: 126139050 - 126140915
Public Clones D065D10 (ggtc) IST14941A8 (tigm)
Private Clones OST226013 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24047
Vector Insertion
Chr 4: 126138332 - 126138928
Public Clones not available
Private Clones OST236642 (lexicon) OST82594 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4568
Vector Insertion
Chr 4: 126131669 - 126136352
Public Clones AD0300 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7306
Vector Insertion
Chr 4: 126131193 - 126131548
Public Clones RRT483 (baygenomics) RRT484 (baygenomics) RRR031 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34919
Vector Insertion
Chr 4: 126126010 - 126130936
Public Clones IST14472H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27387
Vector Insertion
Chr 4: 126120485 - 126126010
Public Clones not available
Private Clones OST60894 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097888
Sequence
ACTGGCAGCTACTCGGGCGCTAGCAGGGGGAGCTGCTGCAGGCTCCGCGGCGGCGGCAACGGAGGCTGCGGGGGCGACAGCGCGAGCGGCCGGGCTTCGG

GGGGGAGCCGAGCCCGGCCCGGGAGCCCGAGCAGTGCAAGTGCGAGGTACCTAGGCCCCTCACGCTGGACTCCTCAGTCTCCCGGCCGCCTGTCCTCCGC

ACGGGTATATGGGATGGAAGCGGGACCCTCGGGAGCAG - UNI10652 - CGGCAGGTGCCTACCTGCCTCCCCTGCAGCAGGTGTTTCAGGCACCCC

GCCGGCCTGGCATTGGCACTGTGGGCAAACCAATCAAGCTTCTGGCCAATTACTTTGAGGTGGACATTCCTAAGATTGACGTTTACCATTACGAGGTGGA

CATCAAGCCGGATAAGTGTCCTCGCAGAGTCAACCG - UNI10430 - GGAGGTGGTGGAATACATGGTCCAGCATTTCAAACCGCAGATCTTTGGGG

ATCGCAAGCCTGTGTATGATGGAAAGAAGAATATTTACACGGTCACAGCACTGCCCATTGGCAATGAGAGG - UNI24047 - GTTGACTTTGAGGTG

ACAATCCCCGGGGAGGGGAAGGATAGAATTTTTAAGGTCTCCATCAAGTGGCTAGCCATTGTGAGCTGGCGCATGCTGCATGAAGCCTTGGTCAGTGGCC

AGATCCCTGTGCCCCTGGAGTCTGTGCAAGCCCTGGATGTGGCCATGAGGCACCTGGCATCTATGAG GTACACCCCTGTGGGCCGCTCCTTCTTCTCAC

CGCCTGAGGGCTACTACCACCCGCTGGGGGGTGGGCGCGAGGTCTGGTTCGGCTTTCACCAGTCTGTGCGCCCTGCCATGTGGAAGATGATGCTCAACAT

TGATG TCTCAGCCACTGCCTTCTACAAAGCACAGCCAGTGATTGAGTTCATGTGTGAGGTCCTGGACATCAGGAACATAGACGAACAACCCAAGCCCCT

CACGGATTCCCAGCGTGTTCGGTTTACCAAGGAGATAAAAG GCCTGAAGGTGGAAGTGACCCACTGTGGACAGATGAAGAGGAAATACCGCGTGTGTAA

TGTTACCCGCCGCCCTGCTAGCCATCAGAC GTTCCCCTTGCAGCTGGAGAGTGGACAGACTGTGGAGTGCACTGTGGCACAGTATTTCAAGCAGAAATA

TAACCTTCAGCTCAAGTATCCTCACCTGCCCTGCCTACAAGTTGGGCAAGAACAGAAGCATACCTATTTGCCCCTCGAG - UNI4568 - GTCTGTAA

CATTGTGGCTGGGCAGCGGTGCATTAAGAAGCTGACTGACAACCAGACTTCAACCATGATAAAGGCTACAGCTAGGTCGGCCCCAGACAGACAGGAGGAG

ATCAGCCGCCTG - UNI7306 - ATGAAGAATGCTAGCTACAACCTGGATCCCTACATCCAGGAATTTGGAATCAAAGTGAAGGATGACATGACGGAG

GTGACAGGACGTGTGCTGCCGGCGCCCATCTTGCAGTATGGCGGCCGG - UNI34919 - AACCGGGCCATTGCTACGCCCAACCAAGGTGTCTGGGA

CATGCGCGGGAAACAGTTCTACAATGGGATTGAGATCAAAGTCTGGGCCATCGCCTGCTTCGCACCCCAGAAACAGTGTCGAGAAGAGGTGCTCAA - U

NI34919 - GAACTTCACAGACCAGCTTCGGAAGATTTCCAAGGATGCAGGGATGCCCATCCAGGGTCAGCCATGCTTCTGCAAATACGCACAGGGGGC

AGACAGCGTGGAGCCCATGTTCCGGCATCTCAAGAACACCTACTCAGGACTGCAGCTCATTATCGTCATCCTGCCCGGGAAGACGCCAGTGTATG - UN

I27387 - - UNI34919 - CTGAAGTGAAACGTGTCGGAGATACACTCTTGGGAATGGCAACACAGTGTGTGCAGGTGAAGAATGTGGTCAAGACGT

CACCGCAGACTCTGTCCAACCTCTGCCTCAAGATCAATGTCAAACTCGGTGGCATTAACAACATCCTAGTCCCACACCAGCG CTCTGCTGTTTTTCAAC

AGCCAGTGATTTTCCTGGGAGCAGATGTTACACATCCCCCAGCTGGGGATGGGAAGAAACCATCTATCACAGCA GTGGTAGGCAGCATGGACGCACACC

CCAGCCGATACTGTGCCACCGTGCGTGTGCAGCGCCCACGGCAGGAGATCATTGAAGACTTGTCCTATATGGTGCGCGAGCTGCTTATCCAGTTCTACAA

GTCCACCCGCTTCAAGCCCACCCGCATCATCTTCTACCGCGACGGCGTCCCCGAGGGCCAGCTGCCCCAG ATTCTTCACTATGAGCTGCTTGCCATTCG

AGATGCATGCATCAAACTGGAAAAAGACTACCAGCCTGGGATCACATATATTGTGGTGCAGAAGCGCCATCACACCCGCCTGTTCTGTGCTGACAAGAAT

GAGCGG ATTGGGAAGAGTGGTAACATCCCAGCAGGGACCACTGTGGACACCAACATCACCCACCCATTTGAGTTCGACTTCTATCTGTGCAGCCATGCA

GGCATCCAG GGTACCAGCCGACCATCCCATTATTATGTCCTTTGGGATGACAACCGTTTCACAGCAGATGAACTCCAGATCTTGACATACCAGCTGTGC

CACACTTACGTACGATGCACACGTTCTGTCTCTATCCCAGCACCTGCCTACTATGCTCGCTTGGTGGCTTTCCGGGCACGATACCACCTGGTGGACAAGG

AACATGACAG TGGAGAGGGGAGCCACATATCAGGGCAAAGCAATGGGCGAGACCCCCAGGCCCTGGCCAAAGCTGTGCAGGTTCACCAGGATACTCTAC

GCACCATGTACTTCGCTTGAAGGCAGAACGCTGTTACCTCACTGGATAGAAGAAAGCTTTCCAAGCCCTGGGAGCTGTACCACCCAAATCCAGAGGAAGC

AAGGCAGAGGGAGGTGGGGTCGGAAGGAGTATAGGAGGCCTTGTTTCTATCTACAGAGGGGGTATAAGGGTGGGAAGAGGACCAGCAAGACAGACTACCA

GCCAGAAATCACTGATAGCAACCTCATTGTCCTCAACCCCTCTCCCCATCTTGTCATATCCGACCCCCTTGGACCAAAAGGGGCATCACTAGTACCCACC

ATACACACAGTTGTCTCATGTGACTCACAGTGCTAAAGACTCATGCTCAACAGCCTGCTAGGGTCAGCTCTGCAGCCCTGTGGTCAAATGCTGGTATGTT

TGGGTTTGCTATTCTAGATGAGAAAGTGGGTGGGAAGAGGGCAGGAATTTTTAGGAGCCTTAATCAGAAAAGGTCTAGATTTGTTTAAGAAAAAGGAAAA

CAGACTCAGATCAATATTTTAGGATACTAGATGTTTTCATGGGTTCAGAATCCACTTTGTAGGAAGATTTTTAATGCTAATGGTTTGGGTTGCTCCTCCC

CAGCTGCCATCCCCTCCCATCATTCCTCTCCACATTCTCTACCCCATGCACCTTTTCCCTGACAGACATCCAGCCCTCGTAACACTTAAGGCACTATGGC

ACTTAGCTCTGAGGTGACATGACCCTGTCTTCCTTCCGCCTGCTGGTGGGTAACCAGTGCCTTCCCGCAACGGTAATGCTGCAGAACTGCAACCTTTTGT

ACCTTTCTCTGTGGGGTGGGGTGTGGGTGGGAAAGGAGGGAGGGAGGGAGGGCAGAAATAGCCCAATGCCAGCGAGCCTCCAGCCAGAATGCCAGCTAAT

TTTCATTTGAAGGAATTGACTTCCATAATCATTGAGCTTTTAAAAAAAGGTCACAACCTCAAGATGGTTAAAATCCATTGACATTTGCACTTTCAGACGT

GACAAGTCTCCGAGCTGCTGAGATGACTGGCCCTTGGCCTTTCCCCTTTAGCTTCCTCTTTTCCCTGGCCCCACCACCACCCTGCCAGATCTAGAGTTAC

TGTCATAGTATTTCTCATTCTTGGCTTTTTTACCCCTGATGGTAAAGTCTCGTTTCAATATTTCTTAACTGGGGTGTCTTACAGCAGAAGATCGTAAGGA

CTAAAATAAGAAAACAAAAAATCTAAAGGTTATTTTTATACCATAACTTGAGTCTATTGCCAAAATCTGGAAATTCCCTCCCATACCTGATGAGTCTGCA

TTCCAGAAACATGGAGCCGTAAGAGGGAACTGTGGAACTGACTTGTGTTCTGGCCTAGCTAAGTAGGGGGTGGTTGTCTCCCCAAGGTGGGGCTCAGCCT

CTGTCCTTCCTCTGTGCAGACAAAGCCTTGTTCTCGAGACAGCCTCCCTCCAGGGCGCTGTCCTGCCCTCTTCCCTGTAAGTGCATCTTCCCCTTTTCTG

GACTGGACTGTCCTTTGATCCCTGACTAACCGAGACTCTAGCACGTCCTCTGGACAGGCTGGGGAATTTTGCTGCTCCCATTTGCTTCTGTTTACACAAA

TGAAATTTTCCTGTTTCTCACTAGGGCATGTGAGTGGGTGGCATGGGCTTTTCTTTTTCTACCCCTCTCTTGAGGTTCTGGGGTTCAGCTAGCTGTCTTG

CAGGACTGGAAAAGAAGTGGGTTCTAGCTTTGTCTTTGCTGACCTTGAAGCAAGGCCCCCTCTTTCCTTGACCATTCTTTTTTCTTCCTGCATTATTGCT

TGGGATGGGAAATTTGAACCTCCGTGTACAGGTTCCCCTTCTGAGGAGCCTGAGCTTAGGATTGCCCTACTCTGGCGATGAAGCCATGATATGTTAGCTC

TAGCCCAGGCTTAGAGGCCCGCTGGAGAAAGGAAGATCTGAACCCTGGCCTATGGAGTCAAAACCTTTCCCCAAGAGCCCATGTATAGACCCAGATTTGC

TATGCAAATAGTCCAGATTCAGTTATGGCTGGCTACATTATTCAGTAACTTCCCAACAGGTAGCACAAATATTCCTTATGGAAAAAGCCCAGGACTGTTC

AGTAGTTCCTCCTGTACTTTTCTGCTGGCTACAGTATGGAGTGCCCCATGGGCACAGGCCCAGCCGGAGAACAGAACGGAGGGCTCTGGGAAGAGGCAGC

TCACTGGAGAGCCTACATTCCTTACACAAGTGCCTAAACAGAGTGATGCCAACACTCCATCTGCCCTGTCCATCGCCTTCATAGACAGTCTACTTCGTGT

TCCATCACCCTTTGGGGAGGGAGCTCTTTGCAGACAGTGTGTTGTCAACTTGGGTACATTTGGGGGCTTGGATTAAGGGCACTACTCCAGGAGGGTCCAA

TCATTCACCAGCATTTGCAGATGCCCATAGGGAACAGGTGGCTGTCACAACTCCCAGCAACAAGATTTTGTTTTCTCCTTTTTCTTTGCCTCACTCTCTC

CAGTTGGGTTTTAAGCTAGAATGAAAAGCAGTTTCGGTCCTTTGGTATTTATGTGCCATTCATGAAATAAAAGCAAGAGAATGCTGGGCACGATGGCCCA

TGTCTGTAATTCTGTTATCTCAGCACTAAGGCTGAAGCAGAAGATTTGCAAGTTCAGGGTCCACCTGGGCTACTCAGTGAATTCCAGGCCAGTGTGCACT

ATGTAGCAAGACCATGTCTCCATAAAAAAGACCAAGAAAAATGACTTGGGTGACAGATCTTGCTGTGATTTTAAATAATTCTTTGAGACTTAACTACTGA

CCATGTGGGTTCTTCTCATTTAAAGGCAGTATGCACACATTACAAACAGTGTTGCCAAGCCTCAGCTTGTTTGGATTTGGTTTAAGTGGTGCATTGTACC

GAGCTCTGGGAGGATTCCAGCCTCATCTTAGACAGCTCTTTCTCCTCCCCCAACTCCCTCCCATGCCTCCACCCCACCCCCACTGTTCGGCTTTCCCTTT

CCTCTTCTGGCCTTCCCTGGCTTCCTTTTCCTTCTCCCTCTTCCCTCAGCTTGCTTGCTGGCTGGCCTGCCTGCCTGTCTGCCTGTGTGATAATGAATTC

TCTGCATGGCTGCAATGATCCCACTGTTAGTTGGCAAGGTCAGGCTTAGCTCATTGACTACAGAAGACCAAAATCCTGTTTCTCATGCCCAGTGGTGTTA

GCCCTGGGTTGCACTGTCCTCAAGCTTACACTAGGTCAGAGCAGCAGGCCTGTCAAACTGACAAAACTAGTAGGGTTTCTGGCAGGTTCAACACCTCTCC

ATTCTGTGGAGGGGCTTGGAGAAGAGGCAGTGAAGGAGACCGCTGCTTTGAATTCAGTCCAGTGTGACCGATTGGTTGAGGTGCTATTGGCAGCCTGTTG

GGGTCGGCCTGGAGCTACTGTTACTGGGAACTTAAACTTGGACTTTGACTAAAGTTGAACAGAGTATGAAACTGTTCTAGAAATCTAGTTCTCAACTGCG

ACATAGCTCCTCTGTGACTGAGCAGCAAGGCTTTCCAACAGGTTCCTTTTAACCAGAATTCTATGAATGATGCCGGGGACACAGTTTTCTTAGCTGGCCC

ATAGAAGGTCTACAAGGCTGCTAAGTGTTGTAGACCTGGCATCTGGCATCACATAGGAGGATGGAATTTCTTCCCTTTCAGGATAGAAGAGTCACCTCTT

ACCTAGCCAAAAGGCAGTTTTGGGAATTCCTGTCAGGAGGAAAGGTTTGGTTTTGTTTTTTAATTTACTGGGCTTTAGATGGTAGTTCATTATGCCTTCC

TTGGGCAGGGATCATGGCAGGGATACGCAAGGCACTCTAATACTCGGCCTTCTAAGCAGGCTGGGAAAGGGGGATTCTCTGGTTTTCTCTTTCTCCCCAC

TTACTAGGACTTGCCTTCTCCCTGAGCCACGAGAGAGGCTGGGTTGGTGCTCTCCCCTTACTCTGCTCCTACTGACTTAGAACCTCTGGCTGCTGTATGA

TAGCCCAGGAAAGGGAATGGAAAGAATGGGCTCAAAACAATAATGTAAGGAAGGTGGTTTCCTTCCTTAAAAAGGGAAATCAGAAACTCTCCAAGAATTG

TGTAAGTAAAGACAATGTGTCTGAATGCACTGAGTCCTCTGGTGTCATAGCAATAAGGAAAAATGAATTGACTTTCTGTGCATACAGTCCAGCCTGACTG

GTGTATGATGTTGCACTTAGCAGCCATGTGGTGGGCATGTGTGACTACTCTGGGTTTCACTTTATTTTCTAAACTTTTTATTCCTCTCAAGTCCAGCATG

GATGGGGAAATGTCCCTGGAGCCCCGCAGCTGTGTACTTGTTTGCATTTGTTTCCCATTGAGACTTGTGTTTGTGTCCTGCTTTGAGCTGTACCCTGTCC

CGTCCATTGTGAAATTATCCCAGCAGCTGTAATGTACAGTTCCCTTCTCAAGCAAGCAACAGCAGCACAATCTTGTGTTTTATAAAAACAACAGTGGCTT

TTATTTCTAAA
Translation
MEAGPSGAA - UNI10652 - AAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNR - UNI10430 - R

EVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNER - UNI24047 - VDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLES

VQALDVAMRHLASMR RYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDV VSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQ

RVRFTKEIKG GLKVEVTHCGQMKRKYRVCNVTRRPASHQT TFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLE - UNI45

68 - VCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRL - UNI7306 - MKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGR 

- UNI34919 - NRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLK - UNI34919 - KNFTDQLRKISKDAGMPIQGQPCFCKYA

QGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYA - UNI27387 - - UNI34919 - AEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKI

NVKLGGINNILVPHQR RSAVFQQPVIFLGADVTHPPAGDGKKPSITA VVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRI

IFYRDGVPEGQLPQ ILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNER IGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQ GTSR

PSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDS SGEGSHISGQSNGRDPQALAKAVQVHQDTLRTMYFA


For any suggestions or comments, please send an email to unitrap@crg.es