Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041608 (Entpd3)
Chromosomal location
Chr 9: 120448963 - 120476934 (+)
Description
ectonucleoside triphosphate diphosphohydrolase 3 Gene [Source:MGI Symbol;Acc:MGI:1321386]
Human Ortholog
not available
Omim not available
UniTrap UNI37043
Vector Insertion
Chr 9: 120471154 - 120475422
Public Clones CMHD-GT_242E1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047687
Sequence
CTCCGCTTTTCAGCAACCCGCAGCGAAAGCAGCGCCCAG CCCGGAGAGAAGATGTTTACCGTGATGACCCGCCAGCCATGTGAACAGGCAG GCTTCAG

GGCCCTCTCGAGGACTCCTGCCATCGTCACCTTGGTGGTCCTGCTTGTGAGCATTGTGGTACTTGTGACACTTACACTCATCCAGATCCGCCACCCACAG

GTTCTCCCTCCGGGGCTGAAG TATGGCGTCGTGCTCGATGCTGGCTCTTCCAGAACCACTGTCTACGTGTATCAGTGGCCGGCAGAGAAGGAGAATAAC

ACAGGAGTGGTCAGCCAAACTTTCAGATGCAGTGTGAAAG GCTCTGGGATCTCCAGCTATGAGAATAACCCCCAAGATGCCCCCAAAGCCTTTGAGGAC

TGTATACTAAAGTTCAAGGAACAGGTCCCAGAGCACCTCCACGGATCCACCCGCATTTACCTGGGAGCTACAGCTGGGATGCGCTTGCTGAG GTTGCAG

AATGAGACAGCAGCTCGTGAAGTCCTTGAGAGCATCCAAAGCTACTTCAAGTCCCAGCCTTTTGATTTTAGGGGTGCTCAAATCATTTCTGGGCAAGAGG

AAGGGGTGTATGGATGGATTACAGCCAACTATATAATGGGAAATTTCCTGGAG AAGAACCTGTGGCACATGTGGGTGCACCCGCACGGAGTCGACACCA

CAGGAGCCCTGGATTTAGGTGGCGCCTCCACCCAGATATCCTTCGTGGCCGGGGAGAAGATGGAGCCGAACGCCAGCGACACGGTGCAGGTGTCTCTGTA

CGGCTACACGTACACTCTCTACACACACAGCTTCCAGTGCTATGGCCAGAATGAAGCAGAGAAGAAGTTCCTGGCCATGCTTCTACAG AGCCCTTCCAC

GGAAGCCAACATCAGCAACCCCTGCTACCCTCAGGGCTACAGTACCGCCTTCACCTTGGGCCATGTGTTTGGCAGCCTGTGCACAGAGAAGCAGAGGCCA

GAGAGCTACAACTCCAGTAAGAGCGTCACCTTCATGGGAACTGGTGACCCACGACTGTGCAGGGAGAAGGTGGCTTCTGTGTTTGACTTCAATGCTTGCC

AAGAGCAAGACGCCTGTTCCTTTGATGGCATTTACCAGCCCAAGGTTCAAGGGCCATTTGTG GCGTTCGCAGGCTTCTACTACACAGCCAGTGCGCTAA

ACCTCTCAGGAAGCTTCTCCCTTACCTCCTTCAATGACAGCAGCTGGGACTTCTGCAGACACACTTGGAGCGAG CTCCCAGCCCTGCTCTCCAGATTTG

ATGAGACGTATGCCCGGTCCTACTGCTTCTCAGCCCACTACATCTACCACTTGCTCGTAAATGGATACAAGTTCACTGAGGAGACTTGGCCTCAGATACG

CTTTGAAAAAGAA - UNI37043 - GTGGGGAACAGCAGCATCGCCTGGTCCCTTGGCTACATGCTCAGCTTGACCAACCAGATCCCAGCTGGAAGTC

CCCTGATCCATCTACCCATACAGCCACCGGTGTTTATGGGAGTCCTGGCCTTCTTCACAGCTATCGCCTTGCTGTGCCTGGCATTTCTTCTGTATCTATG

TTCATCATTCAGGACAAAGGAGCGCTCTGAGAATGCCTTCGACCAAGCAGTGGATTCTGATTGAGCCTTCCAAGCAGCACCTGTCACCCCAGGCTGCCAG

AACCCACCAGAGTGACACCACACAGTGTGAGTGAAGTGGCTGCCACCAGGACCTGTCCCGTGCTTAAATGCCAAGGTCATGTGCCTCTCAGCCACTGATT

CCTGCCAGAGCACCTCCTGGGAGTCCCTCATCCACCCAGTGGGGACTGCCTTTGCAATCCTCCCTACCTGCTTGCTGATCCACTGGGAATCAAGGAGACA

CTGGCTGTTGGTGTCAGGGGCTTCACTCTGTCTACTCCAGAGGAAGTTGAGAATATAATTTAATGCAGAAGAATTGACCACGGGCTCGGTTTCCCTTTTC

TCTCCCTCCGTGCTCTTCCTAGCAAGCTGCCCATGAAGGCTCCGACTCTGATACTTCACCCCACCCTGTGGCTTTGACCTAGAGTTCCTTTGCAAGACCT

TCCTGTATTTTAGTTGAGTCGAGCCCTATCTCAAGTCACTAATGCTTTTTTTTTAGCAATCTCATAAGCATTAAGCTCCCTGACTGGTAGCTAGTAGCAT

TTAGTGGGGAAGATGATGGCATTTTGAGACAGTTTCATGGAGCCCATGCTAGCTTCCTGCCCACTATGTAGCCAAGAGCAGCCTTGATATCTGTTCTTTT

CCTGAGGGCAGGGATTATGGGTTGTGAGGTCCTCGGGGTGGAACCCCAGAGCTTCATGCATTCTAGGCAACTATTTGACCAACCGAGTCACACGCCCAGC

CTAAGAAGATTCAGCCTCAAGGACAGATGGCCTATGTCATGTAGGCAGACCTGAAGCACAAAGACACACAGAAGTCCCTAAATACAGAGTCCCTATTCTT

ATTTTGGAGTGCCCACTTGGAGCTCTGGTCATGAGGTTGCTACTAGGCATGTGTCCTCCTTGTGTAACTGTCTCCCTGCTGTGTCCTCTTGTAAATCACA

CCCAGTATGGACTGTACTGGGGGGGGGGGCAGTGAGGGGATCTCATTGACCCGGCAGAGCTCCTGCTCAGGGTGCCTTTGGGCTATAAACATGGGGTGTG

CTTTTTTCCCCACTGCTCCCACAGGTATACAGGATCCTGTCCAAAGACATCCCTACATTTCTCCCTGCAGAGTTGCTACACATCTTGACTTTGGGAAAAG

AGAAGGCAGTCTCAGGAATATTTGCCTCCAAAGTGGGATGGGAAAGGTCTTCAAGTTCAGTAGCTACAAGCTACAAATCAATGCTGTGTCTCATGGCTGT

TTGCTGGCTCCATATGGAATAAATTCTTATTTTTATTTT
Translation
 MFTVMTRQPCEQAG GFRALSRTPAIVTLVVLLVSIVVLVTLTLIQIRHPQVLPPGLK YGVVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFRCSVKG

 GSGISSYENNPQDAPKAFEDCILKFKEQVPEHLHGSTRIYLGATAGMRLLR RLQNETAAREVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANY

IMGNFLE KNLWHMWVHPHGVDTTGALDLGGASTQISFVAGEKMEPNASDTVQVSLYGYTYTLYTHSFQCYGQNEAEKKFLAMLLQ SPSTEANISNPCY

PQGYSTAFTLGHVFGSLCTEKQRPESYNSSKSVTFMGTGDPRLCREKVASVFDFNACQEQDACSFDGIYQPKVQGPFV AFAGFYYTASALNLSGSFSLT

SFNDSSWDFCRHTWSE LPALLSRFDETYARSYCFSAHYIYHLLVNGYKFTEETWPQIRFEKE - UNI37043 - VGNSSIAWSLGYMLSLTNQIPAG

SPLIHLPIQPPVFMGVLAFFTAIALLCLAFLLYLCSSFRTKERSENAFDQAVDSD

For any suggestions or comments, please send an email to unitrap@crg.es