Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041624 (Gucy1a2)
Chromosomal location
Chr 9: 3532354 - 3897342 (+)
Description
guanylate cyclase 1, soluble, alpha 2 Gene [Source:MGI Symbol;Acc:MGI:2660877]
RefSeq_dna
NM_001033322 
RefSeq_peptide
NP_001028494.1 
UniGene
Mm.435507 
MGI
MGI:2660877 
Uniprot/SPTREMBL
Q3TNN8 Q3UH83 
Human Ortholog
ENSG00000152402 (GUCY1A2)
Omim not available
UniTrap UNI33372
Vector Insertion
Chr 9: 3533100 - 3579517
Public Clones (sanger) IST10291C7 (tigm) IST11827A3 (tigm) IST14732H6 (tigm) IST10519E1 (tigm)
IST14516B2 (tigm) IST14447A11 (tigm) IST11827A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36566
Vector Insertion
Chr 9: 3582701 - 3634438
Public Clones IST14941G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33395
Vector Insertion
Chr 9: 3637261 - 3758916
Public Clones IST11861A8 (tigm) IST12179G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37980
Vector Insertion
Chr 9: 3759882 - 3797237
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000078143
Sequence
GTGGATAAA GTGATGGAAATCAAAGGACAAATGATCCATGTCCCAGAATCAAGTGCCATTTTGTTTTTGGGATCTCCATGTGTGGACAAGTTGGATGAA

CTGATGGGCCGAGGACTGCATCTCTCAGACATCCCTATTCATGATGCCACCCGAGATGTAATTTTAGTTGGAGAGCAAGCCAAGGCCCAGGATGGCTTGA

AGAAGAGGATGGATAAATTAAAGGCCACATTAGAAAGAACTCACCAGGCCCTGGAAGAAGAAAAAAAGAAGACAGTGGATCTGCTGTATTCCATTTTCCC

TGGTGATGTAGCCCAGCAGTTGTGGCAAGGGCAGCAAGTACAGGCCAGAAAGTTTGATGATGTCACCATGCTCTTCTCTGACATTGTGGGCTTTACAGCC

ATATGTGCTCAGTGTACTCCCATGCAGGTGATCAGCATGCTCAATGAACTCTACACAAGATTTGATCACCAGTGTGGCCTTTTGGATATTTACAAG GTG

GAAACAATAGGGGACGCATACTGTGTGGCATCAGGACTGCACAGGAAAAGCCTATGCCATGCAAAGCCCATTGCTCTGATGGCCTTAAAGATGATGGAGC

TTTCAGAAGAAGTTCTGACTCCCGATGGAAAAGCAATTCAG ATGCGGATAGGCATTCACTCAGGCTCTGTGCTGGCTGGTGTGGTCGGAGTACGAATGC

CACGATATTGTCTTTTTGGAAACAATGTCACTCTGGCAAGCAAATTTGAATCTGGAAGTCATCCTCGGCGTATCAATGTCAGCCCTACTACTTACCA AT

TACTAAAACGAGAAGACAGTTTCACATTTATTCCTCGTTCTCGAGAAGAACTTCCAGACAACTTTCCGAAGGAAATTCCTGGGGTCTGCTATTTCCTGGA

GTTAAGGACTGACCCAAAGCCACCAAAGCCATCCCTATCTTCATCGAGAATAAAAAAGGTTTCCTACAATATTGGCACAATGTTCCTCCGGGAAACAAGC

CTCTGAGACTTGCTGCAGATCAAAGACTCCTCCAAAAAGCACAAGCCCAGACATGGGTCCTCATGAGGAGAGGAAGAAACTATTTCTCTTCCAATGCTCT

GTAAGAACATATAGTAGGTTTTGTGTTAACGTCAGGCAATAATCCTTGAAATGGTGAATAACTGATGTCAACTAAAAACAAAAAGCTGGGTGGTGTGGGG

GAAAAGTATAATGTTTCCATCCATATGAGTATTTCTGGTAATGGATATTTTATTTACAAGTACAGGCAATCAAAAGTAACTAATAGAGCTTATGGTTTTT

TGTTTGTCAGCCATGCAGGTATCTCTCCCTATACATTTATACCACTTTTGAAAGCCAGTTTTAAATATATATTCCTACATTTAGTGAACTGATAGGTAAG

GAATAATCTCTAATTTTCTTTTTCTGAATAGGCATCTCATACATATATTATGGCAGTGTGATTAAACTTCCAAGCAGAAGAACTATAAATTAGCTAAATA

TTTTAGGGATGTTACCTATTTTTATATATCTATAACTATATCTTCTCCTAGATAATTGCATTTCCCACACATGATTAAATATTCAAAATGTGCTGGGGCT

TTGTGGGTAGATTTGATGATGCTATATACAAGTTTCACTTACTTAGAGAGATTAGTGCTTGAACTGGGAATATGTATAACTAAGGATATCAGCTGTTGAG

GAAACATGTGTTTGCTTAGTAAACATACCTTTTAGATTTATTTCATGTAGCTTGGATCCAGAGGAAATGGAATTTTCTAGTAGAAAATAAACCTGTAACT

AAGCTTCAGGAAAGATTTTCTTTTAAATCTAAACACTTGTAAGTTAAAACAAAACACTTTGCAAAACTAGATCCTTTTTACATTAAAACTTACCAATGTA

ATGGTGTATGCAATCTTAAGTGGCTCCATAATCAACATTATCTCTCAAAATGATGTATTAGTAGCTGCCCTTCCTGTCTCTGACCTATGCCTTCAAAGAA

CTGACTGTCACACTCCAAAGCAAATTCTGATATCAGAGTTACTGACGAATATCTGTCAGGCAATTTTGCCAAGAATGTTGTTTCCAATTGCCTAACAACA

AAGCAAAGAAAAGCTCGATTTCATGCCTTTTGGATTCTAAAATGTATATTCTTTGGAGGTTTTGTTGATACAGGCTCTAAAGTATCAAACTGCCTCATGA

ATACTGGTGTAGGCTGAACCTCCAGATTCCACAAACACCATGTATACATAGATAGCATTCCATTGCATGCTCTACTAAATTAAGGACTGCTATCAATAGC

CAACACTGCATGAAAATACTCTTTACAGGCTCACACTGAAATTAGGAGTGCACAGTGTGCAAGAATTTTCATATTTGGAGCCACATATAAAACCTACATA

TCTAAGGAGTTTAGTGATCTGGAAGCATTTGCTGTATTGAAATAATAGGATGGACCTTTTCTTCTTACTCAAGTATCCAGTATGTATTCTCACTGGTAGG

TATGTTTACTGGACACAATATATACTTTTTTTCAGGAATTTGGGCCTGCATTAAACATTCTAAGGTATTGCTATATGTTAATTCCCAAAGTCGTCTGTGA

TTGTTAATCACTGTTCTCTATGTGACTTGGCAACATTTAAATTAGGCAAAGCACTTGTTCTATTCATGATCTTTTTCTAACTTTAGCTGTATTCTCACCC

TGGTATAATTGAGATACTAATTTAACATACTTTACATGGAGAAAGCAAGATATATATTTTCCAGGTTCTATGCTATCACCTGTCTCTTTTTTGCCAAGCA

TAGTTCTGTTTTTACACCATACAGATAAAGGGCCAGAGTATGCCTGTGATGCTTTGTAGCCTGAGGGCAATGTATCCTCAATAGAATAATAACAAATACA

TTTCAAGAAACTTGAATATTAGCTTACCTCCTTCATAGTAGAGAAGGATGAGGAGTGTAGGGAGAGTAGATAGAGTAAGCTGAAAACACAAAGTAGTCTT

GTTCTACTACTGATGAAAATGCCTGATGAAAGCTGACAGTCTCTTACTATTGAAGAACAGGGGAAACAGCCATGCTCACCATAGTCAATTATATCTATTA

TGTGCAGTAACTATGTTTATTATGATATATTCAATTATTTTACACTCAATAAACATGTTCTATAACCATAAGGTTGAAAGAATATTTCCCAGGAATCATG

CAATATATTCTCTGTATTTAAGAAAATTTATGAAAAATATACACACACCCCCACACTCATATCTTTTAAAACCTAATATTTGAAATCCACTCTATTATTC

AGTGATTAAACTATTACTAAATAAACAATTAAATAAAGCTCAAGAGGAGAATTTACTCATTTATTCTCAGTTTTAAAAGCATCACAAATTCTGTATTTGG

TTACATTATTTTACATAGTTAGGAAAGAGCCGTTACACTGTCAGAAATGGCATTTTAAAGAACATTGCATAAATTTATTATATATCCCTAACAGGAAATT

ATATTCTTCAATCACTATAATCTATATTTCTGAAGACAGTCTGAGGAAGTAATATAATCTCTTGTAAGTTTTCTAGACTGTTTCAAATGACCATCATAGT

TACATTCTTTTTTGCTTTATGTGCTTGTAAGGCACTC
Translation
VDK VMEIKGQMIHVPESSAILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKKKTVDLLYSIF

PGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGLLDIYK VETIGDAYCVASGLHRKSLCHAKPIALMALKMM

ELSEEVLTPDGKAIQ MRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQ QLLKREDSFTFIPRSREELPDNFPKEIPGVC

YFLELRTDPKPPKPSLSSSRIKKVSYNIGTMFLRETSL
Transcript ENSMUST00000086620
Sequence
GGAGGAACCTTCCTGCACCCCAATCCCTGATTCCCTCAGCTCCGCAGCGAGAGCGGTGCGCACAGGCGGGCCCTGAGGCTGCGCCTGTAGAGCAGCAGCT

GCAGAGGCGACAGTGGCGGGTCCCCAGCTCATCTCCAGCCCCACTGCTGAGCCTGGGCCCCAAGGAGCCGCTGCAATCCAAGTTCCCGCCATGAGCAGCT

GTCTCGAGGGGCTCAGCGGCCCCAGGGACTCGCGTCTGGGCGAGCCCGAACGCAACGCCAAGCGGCCCCGACGCTCCTGAAGCTGCCTGCCACAGCAGGT

CCCACCAAGGCCCCAGACACCACTGCGTCCCCGCCTCCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCCA

CCACCACCTCCGCTTCCGCTGTCTCAGATGCAATAGTGTCTCCAGCAGCATGTCTCGAAGAAAGATTTCATCCGAGTCTTTCAGCTCTTTGAGCTCTGAC

TACCTGGAGACCAGCCCGGAGGAGGAAGGGGAGTGCCCATTGTCCAGGCTCTGCTGGAATGGCAGCCGGAGCCCGCCAGGGCCACCTGGCTCTAGAGAGG

CCGCTAAGGCTGCCACTTCGGCCCCCGCTGCCTCTGCCGCCGCGGCCTCTGCTGCAGTCGCCGCGGAGTACAAGAGAGCCCAACGCCGCGGAAGGGTCAA

CCTGGACTCACTAGGCGAAAGCATCAGCCTCCTGACGGCGCCCTTG - UNI33372 - CCTCAGACGATACACATGACTCTCAAGAGGACATTGCAGT

ATTATGAACACCAAGTTATTGG TTATAGGGATGCAGAAAAGAATTTCCACAATATCTCTAAAAGATGCTCCTATGCAGACCATTCCAACAAAGAGGAAA

TTGAAGATGTCTCAGGAATTCTTCAGTGCACTGCTAATGTACTCG - UNI36566 - GACTGCAGTTCCAAGAAATTCAAGAAAGATTTGGTGAGGAA

TTCTTTAAGATATGCTTTGATGAGAATGAAAGAGTCCTTCGAGCTGTGGGCAGCACATTGCAGGACTTCTTCAATGGCTTTGATGCATTGTTAGAACACA

TTAGGACTTCTTTTGGGAAACAGGCCACTCTAGAGTCATCATCTTTCCTATGCAAAGAGCTTCCTGAAGGTACTCTCATGCTCCATTACTTCCACCCTCA

CCATACGGTGGGCTTTGCAATGCTGGGAATGATTAAGGCTGCAGGAAAGAGAATCTATCACTTAAATGTGGAAGTTGAACAAATTGAAAATGAGAAACTC

TGCTTTGATGGTTCAAACCCAAGCAATTGCAGCTGTCTTACTTTCCTTATCAAAGAATGTGAAACTACTCAGATCACAAAGGACAATCCACAAGGTACTT

CCCAAGTTCCTGCAGACCTCAGAATCAGCATCAACACCTTCTGCAGAGCCTTCCCCTTCCATTTGATGTTTGACTCTAACATGGTGGTCCTTCAGCTTGG

GGAGGGCCTACGGAAACAACTTCGATATGACACTCACAGAGCACTGAAGTTTGAGGACTGTTTTGAGATCGTCTCTCCAATGATTAATGCCACCTTTGAT

AGAGTCTTGCTACGATTGTCCACTCCATTTGTTATAAGGACCAAGCCCGAAGCTTCTGGTACTGAGAATGAAGATAAGGTAA GAAAAATCAT AAAAGT

TCAACATTTGG TTTTTTTT
Translation
MSRRKISSESFSSLSSDYLETSPEEEGECPLSRLCWNGSRSPPGPPGSREAAKAATSAPAASAAAASAAVAAEYKRAQRRGRVNLDSLGESISLLTAPL 

- UNI33372 - PQTIHMTLKRTLQYYEHQVIG GYRDAEKNFHNISKRCSYADHSNKEEIEDVSGILQCTANVLG - UNI36566 - GLQFQEIQE

RFGEEFFKICFDENERVLRAVGSTLQDFFNGFDALLEHIRTSFGKQATLESSSFLCKELPEGTLMLHYFHPHHTVGFAMLGMIKAAGKRIYHLNVEVEQI

ENEKLCFDGSNPSNCSCLTFLIKECETTQITKDNPQGTSQVPADLRISINTFCRAFPFHLMFDSNMVVLQLGEGLRKQLRYDTHRALKFEDCFEIVSPMI

NATFDRVLLRLSTPFVIRTKPEASGTENEDKVR RKII IKVQHLV VFF
Transcript ENSMUST00000115733
Sequence
GGAGGAACCTTCCTGCACCCCAATCCCTGATTCCCTCAGCTCCGCAGCGAGAGCGGTGCGCACAGGCGGGCCCTGAGGCTGCGCCTGTAGAGCAGCAGCT

GCAGAGGCGACAGTGGCGGGTCCCCAGCTCATCTCCAGCCCCACTGCTGAGCCTGGGCCCCAAGGAGCCGCTGCAATCCAAGTTCCCGCCATGAGCAGCT

GTCTCGAGGGGCTCAGCGGCCCCAGGGACTCGCGTCTGGGCGAGCCCGAACGCAACGCCAAGCGGCCCCGACGCTCCTGAAGCTGCCTGCCACAGCAGGT

CCCACCAAGGCCCCAGACACCACTGCGTCCCCGCCTCCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCACCCA

CCACCACCTCCGCTTCCGCTGTCTCAGATGCAATAGTGTCTCCAGCAGCATGTCTCGAAGAAAGATTTCATCCGAGTCTTTCAGCTCTTTGAGCTCTGAC

TACCTGGAGACCAGCCCGGAGGAGGAAGGGGAGTGCCCATTGTCCAGGCTCTGCTGGAATGGCAGCCGGAGCCCGCCAGGGCCACCTGGCTCTAGAGAGG

CCGCTAAGGCTGCCACTTCGGCCCCCGCTGCCTCTGCCGCCGCGGCCTCTGCTGCAGTCGCCGCGGAGTACAAGAGAGCCCAACGCCGCGGAAGGGTCAA

CCTGGACTCACTAGGCGAAAGCATCAGCCTCCTGACGGCGCCCTTG - UNI33372 - CCTCAGACGATACACATGACTCTCAAGAGGACATTGCAGT

ATTATGAACACCAAGTTATTGG TTATAGGGATGCAGAAAAGAATTTCCACAATATCTCTAAAAGATGCTCCTATGCAGACCATTCCAACAAAGAGGAAA

TTGAAGATGTCTCAGGAATTCTTCAGTGCACTGCTAATGTACTCG - UNI36566 - GACTGCAGTTCCAAGAAATTCAAGAAAGATTTGGTGAGGAA

TTCTTTAAGATATGCTTTGATGAGAATGAAAGAGTCCTTCGAGCTGTGGGCAGCACATTGCAGGACTTCTTCAATGGCTTTGATGCATTGTTAGAACACA

TTAGGACTTCTTTTGGGAAACAGGCCACTCTAGAGTCATCATCTTTCCTATGCAAAGAGCTTCCTGAAGGTACTCTCATGCTCCATTACTTCCACCCTCA

CCATACGGTGGGCTTTGCAATGCTGGGAATGATTAAGGCTGCAGGAAAGAGAATCTATCACTTAAATGTGGAAGTTGAACAAATTGAAAATGAGAAACTC

TGCTTTGATGGTTCAAACCCAAGCAATTGCAGCTGTCTTACTTTCCTTATCAAAGAATGTGAAACTACTCAGATCACAAAGGACAATCCACAAGGTACTT

CCCAAGTTCCTGCAGACCTCAGAATCAGCATCAACACCTTCTGCAGAGCCTTCCCCTTCCATTTGATGTTTGACTCTAACATGGTGGTCCTTCAGCTTGG

GGAGGGCCTACGGAAACAACTTCGATATGACACTCACAGAGCACTGAAGTTTGAGGACTGTTTTGAGATCGTCTCTCCAATGATTAATGCCACCTTTGAT

AGAGTCTTGCTACGATTGTCCACTCCATTTGTTATAAGGACCAAGCCCGAAGCTTCTGGTACTGAGAATGAAGATAAG - UNI33395 - GTGATGGA

AATCAAAGGACAAATGATCCATGTCCCAGAATCAAGTGCCATTTTGTTTTTGGGATCTCCATGTGTGGACAAGTTGGATGAACTGATGGGCCGAGGACTG

CATCTCTCAGACATCCCTATTCATGATGCCACCCGAGATGTAATTTTAGTTGGAGAGCAAGCCAAGGCCCAGGATGGCTTGAAGAAGAGGATGGATAAAT

TAAAGGCCACATTAGAAAGAACTCACCAGGCCCTGGAAGAAGAAAAAAAGAAGACAGTGGATCTGCTGTATTCCATTTTCCCTGGTGATGTAGCCCAGCA

GTTGTGGCAAGGGCAGCAAGTACAGGCCAGAAAGTTTGATGATGTCACCATGCTCTTCTCTGACATTGTGGGCTTTACAGCCATATGTGCTCAGTGTACT

CCCATGCAGGTGATCAGCATGCTCAATGAACTCTACACAAGATTTGATCACCAGTGTGGCCTTTTGGATATTTACAAG GTGGAAACAATAGGGGACGCA

TACTGTGTGGCATCAGGACTGCACAGGAAAAGCCTATGCCATGCAAAGCCCATTGCTCTGATGGCCTTAAAGATGATGGAGCTTTCAGAAGAAGTTCTGA

CTCCCGATGGAAAAGCAATTCAG ATGCGGATAGGCATTCACTCAGGCTCTGTGCTGGCTGGTGTGGTCGGAGTACGAATGCCACGATATTGTCTTTTTG

GAAACAATGTCACTCTGGCAAGCAAATTTGAATCTGGAAGTCATCCTCGGCGTATCAATGTCAGCCCTACTACTTACCA ATTACTAAAACGAGAAGACA

GTTTCACATTTATTCCTCGTTCTCGAGAAGAACTTCCAGACAACTTTCCGAAGGAAATTCCTGGGGTCTGCTATTTCCTGGAGTTAAGGACTGACCCAAA

GCCACCAAAGCCATCCCTATCTTCATCGAGAATAAAAAAGGTTTCCTACAATATTGGCACAATGTTCCTCCGGGAAACAAGCCTCTGAGACTTGCTGCAG

ATCAAAGACTCCTCCAAAAAGCACAAGCCCAGACATGGGTCCTCATGAGGAGAGGAAGAAACTATTTCTCTTCCAATGCTCTGTAAGAACATATAGTAGG

TTTTGTGTTAACGTCAGGCAATAATCCTTGAAATGGTGAATAACTGATGTCAACTAAAAACAAAAAGCTGGGTGGTGTGGGGGAAAAGTATAATGTTTCC

ATCCATATGAGTATTTCTGGTAATGGATATTTTATTTACAAGTACAGGCAATCAAAAGTAACTAATAGAGCTTATGGTTTTTTGTTTGTCAGCCATGCAG

GTATCTCTCCCTATACATTTATACCACTTTTGAAAGCCAGTTTTAAATATATATTCCTACATTTAGTGAACTGATAGGTAAGGAATAATCTCTAATTTTC

TTTTTCTGAATAGGCATCTCATACATATATTATGGCAGTGTGATTAAACTTCCAAGCAGAAGAACTATAAATTAGCTAAATATTTTAGGGATGTTACCTA

TTTTTATATATCTATAACTATATCTTCTCCTAGATAATTGCATTTCCCACACATGATTAAATATTCAAAATGTGCTGGGGCTTTGTGGGTAGATTTGATG

ATGCTATATACAAGTTTCACTTACTTAGAGAGATTAGTGCTTGAACTGGGAATATGTATAACTAAGGATATCAGCTGTTGAGGAAACATGTGTTTGCTTA

GTAAACATACCTTTTAGATTTATTTCATGTAGCTTGGATCCAGAGGAAATGGAATTTTCTAGTAGAAAATAAACCTGTAACTAAGCTTCAGGAAAGATTT

TCTTTTAAATCTAAACACTTGTAAGTTAAAACAAAACACTTTGCAAAACTAGATCCTTTTTACATTAAAACTTACCAATGTAATGGTGTATGCAATCTTA

AGTGGCTCCATAATCAACATTATCTCTCAAAATGATGTATTAGTAGCTGCCCTTCCTGTCTCTGACCTATGCCTTCAAAGAACTGACTGTCACACTCCAA

AGCAAATTCTGATATCAGAGTTACTGACGAATATCTGTCAGGCAATTTTGCCAAGAATGTTGTTTCCAATTGCCTAACAACAAAGCAAAGAAAAGCTCGA

TTTCATGCCTTTTGGATTCTAAAATGTATATTCTTTGGAGGTTTTGTTGATACAGGCTCTAAAGTATCAAACTGCCTCATGAATACTGGTGTAGGCTGAA

CCTCCAGATTCCACAAACACCATGTATACATAGATAGCATTCCATTGCATGCTCTACTAAATTAAGGACTGCTATCAATAGCCAACACTGCATGAAAATA

CTCTTTACAGGCTCACACTGAAATTAGGAGTGCACAGTGTGCAAGAATTTTCATATTTGGAGCCACATATAAAACCTACATATCTAAGGAGTTTAGTGAT

CTGGAAGCATTTGCTGTATTGAAATAATAGGATGGACCTTTTCTTCTTACTCAAGTATCCAGTATGTATTCTCACTGGTAGGTATGTTTACTGGACACAA

TATATACTTTTTTTCAGGAATTTGGGCCTGCATTAAACATTCTAAGGTATTGCTATATGTTAATTCCCAAAGTCGTCTGTGATTGTTAATCACTGTTCTC

TATGTGACTTGGCAACATTTAAATTAGGCAAAGCACTTGTTCTATTCATGATCTTTTTCTAACTTTAGCTGTATTCTCACCCTGGTATAATTGAGATACT

AATTTAACATACTTTACATGGAGAAAGCAAGATATATATTTTCCAGGTTCTATGCTATCACCTGTCTCTTTTTTGCCAAGCATAGTTCTGTTTTTACACC

ATACAGATAAAGGGCCAGAGTATGCCTGTGATGCTTTGTAGCCTGAGGGCAATGTATCCTCAATAGAATAATAACAAATACATTTCAAGAAACTTGAATA

TTAGCTTACCTCCTTCATAGTAGAGAAGGATGAGGAGTGTAGGGAGAGTAGATAGAGTAAGCTGAAAACACAAAGTAGTCTTGTTCTACTACTGATGAAA

ATGCCTGATGAAAGCTGACAGTCTCTTACTATTGAAGAACAGGGGAAACAGCCATGCTCACCATAGTCAATTATATCTATTATGTGCAGTAACTATGTTT

ATTATGATATATTCAATTATTTTACACTCAATAAACATGTTCTATAACCATAAGGTTGAAAGAATATTTCCCAGGAATCATGCAATATATTCTCTGTATT

TAAGAAAATTTATGAAAAATATACACACACCCCCACACTCATATCTTTTAAAACCTAATATTTGAAATCCACTCTATTATTCAGTGATTAAACTATTACT

AAATAAACAATTAAATAAAGCTCAAGAGGAGAATTTACTCATTTATTCTCAGTTTTAAAAGCATCACAAATTCTGTATTTGGTTACATTATTTTACATAG

TTAGGAAAGAGCCGTTACACTGTCAGAAATGGCATTTTAAAGAACATTGCATAAATTTATTATATATCCCTAACAGGAAATTATATTCTTCAATCACTAT

AATCTATATTTCTGAAGACAGTCTGAGGAAGTAATATAATCTCTTGTAAGTTTTCTAGACTGTTTCAAATGACCATCATAGTTACATTCTTTTTTGCTTT

ATGTGCTTGTAAGGCACTC
Translation
MSRRKISSESFSSLSSDYLETSPEEEGECPLSRLCWNGSRSPPGPPGSREAAKAATSAPAASAAAASAAVAAEYKRAQRRGRVNLDSLGESISLLTAPL 

- UNI33372 - PQTIHMTLKRTLQYYEHQVIG GYRDAEKNFHNISKRCSYADHSNKEEIEDVSGILQCTANVLG - UNI36566 - GLQFQEIQE

RFGEEFFKICFDENERVLRAVGSTLQDFFNGFDALLEHIRTSFGKQATLESSSFLCKELPEGTLMLHYFHPHHTVGFAMLGMIKAAGKRIYHLNVEVEQI

ENEKLCFDGSNPSNCSCLTFLIKECETTQITKDNPQGTSQVPADLRISINTFCRAFPFHLMFDSNMVVLQLGEGLRKQLRYDTHRALKFEDCFEIVSPMI

NATFDRVLLRLSTPFVIRTKPEASGTENEDK - UNI33395 - VMEIKGQMIHVPESSAILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGE

QAKAQDGLKKRMDKLKATLERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQC

GLLDIYK VETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEEVLTPDGKAIQ MRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRR

INVSPTTYQ QLLKREDSFTFIPRSREELPDNFPKEIPGVCYFLELRTDPKPPKPSLSSSRIKKVSYNIGTMFLRETSL

For any suggestions or comments, please send an email to unitrap@crg.es