Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041632 (Mrps27)
Chromosomal location
Chr 13: 100114745 - 100185517 (+)
Description
mitochondrial ribosomal protein S27 Gene [Source:MGI Symbol;Acc:MGI:1919064]
RefSeq_dna
NM_173757 
RefSeq_peptide
NP_776118.2 
MGI
MGI:1919064 
Uniprot/SWISSPROT
Q8BK72 
Uniprot/SPTREMBL
Q6A096 Q80ZI4 
Human Ortholog
ENSG00000113048 (MRPS27)
Omim not available
UniTrap UNI29773
Vector Insertion
Chr 13: 100114831 - 100118286
Public Clones (sanger) D060F04 (ggtc) E076H10 (ggtc) D060D03 (ggtc) D062H03 (ggtc)
D060C03 (ggtc) IST14820C8 (tigm) IST14945A5 (tigm) IST11566H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3596
Vector Insertion
Chr 13: 100118365 - 100132919
Public Clones (sanger) BB0744 (sanger) YTC271 (baygenomics) HMA485 (baygenomics)
Private Clones OST435461 (lexicon) OST262830 (lexicon) OST262208 (lexicon) OST82131 (lexicon)
OST31073 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24470
Vector Insertion
Chr 13: 100132991 - 100135179
Public Clones IST10979D1 (tigm)
Private Clones OST218740 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27320
Vector Insertion
Chr 13: 100135239 - 100170216
Public Clones not available
Private Clones OST63403 (lexicon) OST43495 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16319
Vector Insertion
Chr 13: 100182321 - 100184693
Public Clones IST12497C6 (tigm)
Private Clones OST463246 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052249
Sequence
GGTGCGCTCCAAGATGGCGGCTCCCATGGTGCGGTGTGGGATGCTCCTGGCTCGGCGACTAGACGCGTCTCGCCTTTGCCTCGCAG - UNI29773 - 

GTAAAAGATGCCTGCTTTCTGCAGCGTACGTGGACAGCCACCAGTGGGAAGCCAGAGAGAAGGAGGAATACCATCTGG - UNI3596 - CTGATCTTG

CATCCTTAATGGACAAAGCGTATGAAAGAAAATTGCCTGTTAGTTCTTTATCAATATCACGG - UNI24470 - TTTGTGGACAACATTGCATCCCGA

GAAGATCTAGATTCTGCAGAGTACTATCTTTACAA - UNI27320 - ATTTCGACACAGTCCCAACTGCTGGTACCTAAGAGACTGGACCATCCACAG

CTGGATTAGACAGTGTCTGAAATACGGAGCACAAGACAAAGCCTTGTATACACTTGTTAATAAG GTTCAGTATGGAATTTTTCCAGATAACTTTACATT

CAACTTACTGATGGATTATTTCATAAAGAAAGGAAATTACAAAG ATGCTTTATCCGTGGTTTTTGAGATCATGATGCAAGAAGCCTTTGACGTGCCGTC

CACCCAGTTTCTCTCCCTCTATGTTTTATACCGTTGCCTAGCAGAGAAGACGGAGCTCACA TGGGAAGAAGAAAGAGACTTTGGGGCGTCCCTCTTGCT

TTCTGGCCTGAAACAAAGGAACACAGTGGGCCTGAGTTCCCAGCTGTATGGCTATGCACTTCTCG GGAAGGTGGAACTGCAGCGTGGGGTGCGGGCTGT

ATACCACGGCATGCCTCTGATGTGGACACCAGGCTACCTCGACAGAGCCCTCCAAGTGATGGAGAGGGTGGCCTCCTCCCCTGAAGACCTCAAGCTGGGT

AGAGAAGTG CTCGATGTGCTGGATGGAGTCCTGAAGGTGGTGACGTCTCCAGATGTCCAGACTTCAGAGGCACAGCCTCAGGAAGGTGAAGATGGCTTG

GGCTCAGCAAACCTGGTGGAGCAGCTAGACACTGAGGAACCAGAACAGTCCAAGCTTCCCCGATACCTCGAGCGCTTTCAG - UNI16319 - GCCTC

TCGGTCTAAACTGCAGGAGCTGAACAGAGTTGAGTCTGAAAGTCTTTTGACTCTGACCACCCAGCTTGTAAAAGAAAAACTCCCCGCCTGTGAGGCCGAG

GACCTGGCCACCTACGAGCAGAAACTCCGTGAGTGGCACCTGGAGCGGGTGCAGTTGATCCAGAGGGAGCAGGAACAGAGGGAGAAGGCCAAGCAAGAGT

ACCAGGCGCTGAGTGCGGCAGAGAAAGCAGCCTGAAGTTCTGTGAGCCACCTCAGTGTTCAGCCAGGACAGCATGGGGCTCCGCCGCTACTGTCCAGTTC

TTTTCTTACAGGAAGCTGTGCATAGCCTGAAAACAAGGATGGCTCTATGCCAAGACACTGTCTGCCCATCTAGATGTCAAGGGCCCTGAACTAAGTGACA

AACGGTTGGGCTGAAGCCCCCACACAGTGGAGTCCTGGGTGCAGACTGGGAATATCGGGTGAGCGTGACGGGAAGCTATAGCTGAAGGGTCGGCTCTGCA

GCACGGGTGTTTGAATGATTTCCTGCCCTTGGCCATGTGCATGGAGCACCGAGCTTCATGACCAGGTGCTGGTAGACTCAGAACCACCCACGTTCCAGAA

CCGGGTGCTTGCTCCTTTCACCCGCTTCCAGGACTCAGCACCAGTGGCCACATGACCTGCTGTCAGTGTGACACATTTCCACTGTTAACACTGGTCTCAT

ATTCTCCCTGTGCATATGTGCCATATATAGCTGGCACCTTCATGGTCTGTCCCCTTCCCATCACTGCTCAGAAGCAGCCTTTTGTATACCTGCCTCCCCA

ATAAATCCTACCCATGTGG
Translation
MAAPMVRCGMLLARRLDASRLCLAG - UNI29773 - GKRCLLSAAYVDSHQWEAREKEEYHLA - UNI3596 - ADLASLMDKAYERKLPVSSLS

ISR - UNI24470 - FVDNIASREDLDSAEYYLYK - UNI27320 - KFRHSPNCWYLRDWTIHSWIRQCLKYGAQDKALYTLVNK VQYGIFPDN

FTFNLLMDYFIKKGNYKD DALSVVFEIMMQEAFDVPSTQFLSLYVLYRCLAEKTELT WEEERDFGASLLLSGLKQRNTVGLSSQLYGYALLG GKVEL

QRGVRAVYHGMPLMWTPGYLDRALQVMERVASSPEDLKLGREV LDVLDGVLKVVTSPDVQTSEAQPQEGEDGLGSANLVEQLDTEEPEQSKLPRYLERF

Q - UNI16319 - ASRSKLQELNRVESESLLTLTTQLVKEKLPACEAEDLATYEQKLREWHLERVQLIQREQEQREKAKQEYQALSAAEKAA

For any suggestions or comments, please send an email to unitrap@crg.es