Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041650 (Pcca)
Chromosomal location
Chr 14: 122933561 - 123289166 (+)
Description
propionyl-Coenzyme A carboxylase, alpha polypeptide Gene [Source:MGI Symbol;Acc:MGI:97499]
RefSeq_dna
NM_144844 
RefSeq_peptide
NP_659093.1 
UniGene
Mm.23876 Mm.474301 
MGI
MGI:97499 
Uniprot/SWISSPROT
Q91ZA3 
Uniprot/SPTREMBL
Q3UGC8 
Human Ortholog
ENSG00000175198 (PCCA)
Omim 606054 - PROPIONIC ACIDEMIA  
UniTrap UNI31197
Vector Insertion
Chr 14: 122962210 - 122981838
Public Clones IST14876D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8207
Vector Insertion
Chr 14: 122984333 - 123015975
Public Clones RRI040 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31165
Vector Insertion
Chr 14: 123189677 - 123212415
Public Clones IST10441B8 (tigm) IST13729B10 (tigm) IST11831A7 (tigm) IST13099A10 (tigm)
IST13814B5 (tigm) IST14473E4 (tigm) IST14138F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038374
Sequence
AGCAGCCGGCAAGTCTGCGGGGTGGACGATGGCGGGGCAGTGGGTCAGGACCGTGGCGCTGTTGGCGGCCAGGCGGCATTGGCGGCGGTCCTCGCAGCAG

CAATTGCTGGGGACGCTGAAG CATGCTCCAGTCTATTCATACCAATGCCTAGTGGTGTCCAGAAGTCTCAGTTCTGTGGAATATGAGCCTAAAGAAAAG

 ACTTTTGATAAAATTCTCATTGCTAACAGAGGAGAAATTGCCTGTAGG GTTATTAAAACTTGCAAGAAGATGGGCATCAAGACAGTTGCCATTCACAG

TGATGTTGATGCCAGTTCT - UNI31197 - GTTCACGTGAAAATGGCGGATGAGGCTGTCTGTGTTGGCCCAGCTCCCACCAGTAAAAGCTACCTCA

ACATGGATGCCATCATGGAAGCCATTAAGAAAACCAGGGCCCAAGCT GTACACCCAGGGTATGGATTCCTGTCAGAAAACAAAGAGTTTGCAAAGCGTC

TG - UNI8207 - GCAGCAGAAGATGTCACTTTCATTGGACCTGATACTCATGCTATTCAAGCCATGGGTGACAAGATAGAAAGCAAACTATTAGCCA

AGAGAGCAAAGGTCAACACAATCCCTGGTTTTGATGGGGTAGTAAAG GATGCAGATGAAGCTGTCAGAATTGCAAGGGAAATTG GCTACCCTGTGATG

ATCAAGGCCTCAGCAGGCGGTGGTGGGAAAGGCATGCGCATCGCCTGGGATGACGAAGAGACCAG GGATGGCTTTAGATTTTCATCCCAGGAAGCTGCT

TCTAGTTTTGGTGATGATAGACTACTAATAGAAAAATTTATCGATAACCCTCGTCATATAGAAATCCAG GTTTTAGGGGATAAACATGGCAATGCTCTG

TGGCTCAATGAGAGGGAGTGCTCGATCCAGAGAAGGAACCAGAAGGTGGTAGAGGAGGCGCCAAG CATTTTTCTGGATCCTGAAACTCGCCAAGCAATG

GGAGAGCAGGCCGTGGCTTTGGCTAAAGCCGTGAAGTATTCTTCTGCTGGAACTGTGGAATTTCTTGTGGACTCCCAGAAGAATTTTTACTTCTTGGAGA

TGAATACAAGACTACAG GTCGAACATCCTGTCACAGAGTGCATTACTGGCCTGGACTTAGTCCAAGAAATGATCCTTGTTGCTAAGGGTTACCCACTCA

GGCACAAGCAAGAGGATATTCCCATCAGTGGCTGGGCAGTTGAATGTCGGGTTTATGCTGAG GACCCCTACAAGTCTTTCGGTTTACCGTCTATTGGGA

GGCTGTCCCAGTACCAAGAGCCGATACATCTACCTGGT GTCCGAGTTGACAGTGGCATCCAACCAGGAAGTGACATCAGCATCTATTATGATCCTATGA

TTTCAAAG CTAGTCACATATGGGTCTGACAGAGCAGAAGCCCTGAAGAGGATGGAAGACGCACTGGACAATTATGTGATCCGGG GTGTTACACACAAC

ATCCCATTGCTCCGGGAGGTGATAATCAACACACGTTTTGTGAAAGGAGACATCAGCACTAAGTTTCTCTCTGATGTGTATCCTGATGGCTTCAAAG GG

CACACGTTAACACTGAGTGAGAGAAACCAGTTATTGGCCATTGCATCATCTGTATTTGTGGCATCCCAGCTACGAGCTCAGCGCTTCCAAGAACATTCAA

G AGTACCAGTTATTAGGCCTGATGTGGCTAAGTGGGAGCTCTCGGTAAAGTTACATGATGAAGATCATACTGTCGTGGCATCTAACAATGGGCCGGCAT

TTACC GTGGAAGTTGATGGCTCGAAACTAAATGTGACCAGTACGTGGAACCTGGCGTCACCCTTATTGTCTGTCAACGTTGATGGCACGCAGAGGACTG

TGCAG - UNI31165 - TGTCTTTCTCGGGAAGCAGGTGGAAACATGAGCATCCAGTTTCTTGGCACAGTG TACAAAGTGCACATTTTAACCAAGCT

TGCTGCAGAGCTGAACAAATTCATGCTTGAAAAAGTGCCCAAGGACACCAGCAGCACTCTGTGCTCCCCGATGCCTGGAGTGGTGGTGGCCGTTTCTGTC

AAGCCTGGAGACATG GTAGCAGAAGGTCAGGAAATCTGTGTGATTGAAGCTATGAAAATGCAGAACAGTATGACAGCTGGGAAAATGGGCAAG GTGAA

ATTGGTGCACTGCAAAGCTGGAGACACAGTTGGTGAAGGAGACCTGCTTGTGGAGCTGGAATGAAGTATTTCTAGCCTTTCCGTCAGCACTGCTCACTGC

TTTAACTGGCGTCTCCATTATTCTCTAACCCTCAATTTGCGCAAGCATTTACAGGAGCACTCCTGTGCAGGAGGTTCTACAGCCTCCTGTTTATTCCTCA

GAAGAGGCAAAACCGACATTCTGCCAACAAATCACCAATGGAAATTCTTGATATAAATACTTGTACATATGATTTGTACTTCTGCTGAGATTTCCTAGTG

TCAAAATTAAATCAATAAAACCAAGCATTTGTCTAAATATTAGTTTGCCCTTTTTTCCGAATGAAGACAATATACACAGAGGCGACAGGCTGTGCCAATT

GACTGTAAATATTAGCATTTCATTGTGATTCTTTAAAAATTTATATAAATTCC
Translation
MAGQWVRTVALLAARRHWRRSSQQQLLGTLK HAPVYSYQCLVVSRSLSSVEYEPKEK TFDKILIANRGEIACR VIKTCKKMGIKTVAIHSDVDASS 

- UNI31197 - VHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQA VHPGYGFLSENKEFAKRL - UNI8207 - AAEDVTFIGPDTHAIQA

MGDKIESKLLAKRAKVNTIPGFDGVVK DADEAVRIAREIG GYPVMIKASAGGGGKGMRIAWDDEETR RDGFRFSSQEAASSFGDDRLLIEKFIDNPR

HIEIQ VLGDKHGNALWLNERECSIQRRNQKVVEEAPS SIFLDPETRQAMGEQAVALAKAVKYSSAGTVEFLVDSQKNFYFLEMNTRLQ VEHPVTECI

TGLDLVQEMILVAKGYPLRHKQEDIPISGWAVECRVYAE DPYKSFGLPSIGRLSQYQEPIHLPG VRVDSGIQPGSDISIYYDPMISK LVTYGSDRAE

ALKRMEDALDNYVIRG GVTHNIPLLREVIINTRFVKGDISTKFLSDVYPDGFKG GHTLTLSERNQLLAIASSVFVASQLRAQRFQEHSR RVPVIRPD

VAKWELSVKLHDEDHTVVASNNGPAFT VEVDGSKLNVTSTWNLASPLLSVNVDGTQRTVQ - UNI31165 - CLSREAGGNMSIQFLGTV YKVHIL

TKLAAELNKFMLEKVPKDTSSTLCSPMPGVVVAVSVKPGDM VAEGQEICVIEAMKMQNSMTAGKMGK VKLVHCKAGDTVGEGDLLVELE

For any suggestions or comments, please send an email to unitrap@crg.es