Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041685 (Fcho2)
Chromosomal location
Chr 13: 99493369 - 99585404 (-)
Description
FCH domain only 2 Gene [Source:MGI Symbol;Acc:MGI:3505790]
RefSeq_peptide
NP_766179.1 
UniGene
Mm.398551 Mm.23928 Mm.413221 
MGI
MGI:3505790 
Uniprot/SWISSPROT
Q3UQN2 
Uniprot/SPTREMBL
Q05CX7 Q3TPU3 Q3TTY1 
Human Ortholog
ENSG00000157107 (FCHO2)
Omim not available
UniTrap UNI4478
Vector Insertion
Chr 13: 99585030 - 99585102
Public Clones AH0519 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16655
Vector Insertion
Chr 13: 99576353 - 99585030
Public Clones not available
Private Clones OST456279 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26247
Vector Insertion
Chr 13: 99559829 - 99566247
Public Clones not available
Private Clones OST128565 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9698
Vector Insertion
Chr 13: 99534505 - 99545775
Public Clones XG049 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20822
Vector Insertion
Chr 13: 99533718 - 99534459
Public Clones not available
Private Clones OST351024 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9558
Vector Insertion
Chr 13: 99505086 - 99513365
Public Clones XE480 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11816
Vector Insertion
Chr 13: 99495732 - 99496015
Public Clones F015E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109403
Sequence
ATTAGCTCCGCCCCCCGGGCCTGCGGGTAGCTCGACTCCCGCCAGCCCCGGAGGCTCGCGCAGACTAAGCTCTGTACCATTCCTTGCGAACGCTCGGACC

CGGACAGGCTGCGCGCACGCGCACTCGGGAGCGACAGTCAGGCTCTCGCCCCGTGGTGGCGGCGGCCGCGCCTGCCGCTAGGTGGCGCATGCGCCCTAGA

GGGCGCGGGCGGTCTCTGGGAAGAAGGCGGCGGCGGCGAGAGGCGGGGGCGCCGTAGGGGCCGGTCCGTGTTTACACAGCGGCGGGCGGGTGCGGACGCG

GAACCCGGCGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAAGATGGTCATGGCGCATTTCGTGGAGAATTTCTGG - UNI4478 - - UNI16655 - 

GGGGAAAAAAATAATGGCTTTGATGTACTGTACCATAATATGAAGCATGGACAGATATCAACTAAAGAACTAGCAGATTTTGTAAGAGAAAG AGCTACA

ATAGAAGAGGCATACTCCAGATCAATGACAAAACTAGCGAAATCTGCAAGCAATTATTCACAACTTGG - UNI26247 - AACATTTGCACCAATGTG

GGATGTATTCAAAACATCTACAGAGAAATTAGCAAATTGTCATTTGGATCTTGTTAGAAAATTACAGGAATTAATAAAGGAAGTTCAGAAGTATGGAGAG

GAGCAAGTCAAGTCTCATAAGAAG ACTAAAGAAGAAGTCGCAGGGACTCTGGAAGCAGTCCAAGCCATTCAGAATATAACTCAGGCACTCCAGAAGTCG

AAGGAAAATTACACTGCCAAATGTGTAGAACAGGAACGTCTGAAAAAGGAAGGAGCTACACAAAGAGAAATAGAAAAG GCAGCTGTTAAGTCTAAGAAA

GCTACAGATACTTATAAACTTTATGTGGAAAAGTATGCATTAACAAAAGCAGATTTTGAGCAGAAGATGACAGAAACAGCCCAG AAATTTCAAGATATT

GAAGAAACTCACCTCATTCACATAAAGGAAATTATCGGATCCTTGTCAAATGCTGTCAAGGAGATCCACTTACAGATCGGCCAG GTTCATGAAGAGTTT

ATAAATAACATGGCTAATACTACAATTGAAAGTTTGATTCAGAAATTTGCCGAGTCAAAAGGCACAGGGAAGGAAAGACCTG - UNI9698 - GTCTT

ATTGAATTTGAAGAGTGTGACCCTGCTAGTGCAGTTGAAG - UNI20822 - GCATAAAACCAAGGAAAAGAAAGACTTTTGCTTTGCCTGGAATAAT

TAAAAAGGAAAAGGACGCAGAATCTGT GGAATGTCCTGATGCAGATTCGCTT AATATTCCAGATGTAGATGAAGAAGGTTTCAGTATTAAACCAGAAG

CAAATCAGAATGAT ACCAAAGAGAACCATTTCTACTCATCCAGTGACTCTGACTCTGAAGATGAAGAACCAAAGAGGTACCGGATAGAGATCAAGCCCG

CGCATCCAAATAACTTGCATCACACAATGGCTTCTTTGGATGAACTGAAAGTATCCATAGGGAATATAACATTGTCCCCAGCAGTATCT GGTTTCCTT
Translation
MVMAHFVENFW - UNI4478 - - UNI16655 - GEKNNGFDVLYHNMKHGQISTKELADFVRER RATIEEAYSRSMTKLAKSASNYSQLG - UN

I26247 - GTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKK TKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKKE

GATQREIEK AAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQ KFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQ VHEEFINNMANTTIESLIQK

FAESKGTGKERPG - UNI9698 - GLIEFEECDPASAVEG - UNI20822 - GIKPRKRKTFALPGIIKKEKDAESV VECPDADSL NIPDVDEE

GFSIKPEANQND TKENHFYSSSDSDSEDEEPKRYRIEIKPAHPNNLHHTMASLDELKVSIGNITLSPAVS GFL
Transcript ENSMUST00000099277
Sequence
GAAATTATGAG AAAGGGTCTCACTGTGCAGCTCTGGCTGTCCTGGAACTCAATATGCAGACCAGGCTGTCCTCAAACTCAAAGAGATCCTCCCGTCTCT

ATCTTCCAAGTGCTGGGGTTAAAG AATATTCCAGATGTAGATGAAGAAGGTTTCAGTATTAAACCAGAAGCAAATCAGAATGAT ACCAAAGAGAACCA

TTTCTACTCATCCAGTGACTCTGACTCTGAAGATGAAGAACCAAAGAGGTACCGGATAGAGATCAAGCCCGCGCATCCAAATAACTTGCATCACACAATG

GCTTCTTTGGATGAACTGAAAGTATCCATAGGGAATATAACATTGTCCCCAGCAGTATCT AGACACAGTCCA GTGCAGATGAATCGGAATTCATCTA 

ATGAAGAATTAACAAAATCAAAGCCGTCTTCTCTACCCACTGA GAAAGGGACCAATGATTTACTTGCTTGGGATCCCCTGTTCGGATCGTCGCTTGAGT

CATCTTCAGCTCCACTAACTTCGTCATCATCGG CCAGACCCACGACACCTCTCTCTTTAGGCACCCTTGTTCCACCTCCAAGGCCTGCTTCCAGACCAA

AGCTTGCTTCAGGAAAACTGAGTGGGATCAATGAAATA CCCAGGCCATTCAGCCCACCTGTAACTTCCAACACCAGCCCACCTCCTACTGCTCCCTTAG

CCCGAGCCGAGAGCAGCTCCTCTATCTCCTCGTCTGCCTCGTTGAGTGCTGCCAACACTCCAACAGTAG - UNI9558 - GTGTATCACGGGGTCCCA

GCCCGGTCAGCCTTGGAAACCAGGACACTTTACCTGTGGCAATCGCCCTTACAGAATCTGTCAACGCCTACTTTAAAGGAGCAGATCCTACCAA GTGTA

TTGTGAAGATCACGGGAGACGTGACAATATCATTTCCCAGTGGGATTATTAAAGTCTTCACCAGCAACCCCTCCCCAGCTGTGCTGTGCTTTAGGGTGAA

GAACATCAGCAGGCTGGAGCAGATCCTTCCAAACTCCCAGCTTGTGTTCAG TGATCCATCACAGTGTGATTCCAACACAAAAGATTTTTGGATGAACAT

GCAAGCTGTTACTATCTACCTCAAGAAGCTATCAGAACAAAATCCAGCTGCTTCTTATTATAATGTAGATGTATTAAAATACCAG GTATCATCAAATGG

CATTCAGTCCACTCCTCTAAATCTTGCAACCTACTGGAAATGTAGTGCCAGCACCACAGATCTGAGAGTGGATTATAAGTACAACCCAGAAGCTATGGTC

GCTCCGAGTGTGCTTTCCAACATACAGGTGGTGGTTCCCGTGGATGGAGGTGTCACAAATATGCAGTCCCTTCCTCCTGCAATATG GAATGCAGAGCAA

ATGAAAGCTTTTTGGAAATTATCTGGGATTTCGGAGAAATCAGACAGTGGAG GTTCTGGATCCCTCAGAGCAAAATTTGATCTTTCAGAAGGACCCAGC

AAACCTACAACACTGGCAGTGCAATTCCTCAGTGAGGGCAATACGCTCTCAGGAGTGGATATTGAGCTTGTGGGTACTGGCTATAGACTTTCCTTAGTAA

AGAAGCGCTTTGCCACTG - UNI11816 - GACGATACTTGGCAGATTGTTGATGGACCCCGAATGCGGTTTTCTCAAGGGAATAGTGTGCACCTGCC

ACTCTGCCTCGCCTGTTCCTTCCAAACACTATTTTTACTTGTATGATGTCTTTCAAATTTGCTCTTTGAAAGCTGACTACAAACATTAACTTGCACTTTC

AAAGTGTCATTGAAAGAAATAGCACTGAAATGACCTTGTACACAGTAAATGATCAAATGCAATATTCTGGAAGCACATTAATTCAAATTGTCACTAAAAT

GAAGTCTATTATCTTCAGTGTCTGTGTTCTTAAAAAGGTTAGAATGTAGTAACAAGCCTAACATTTCAGGAGAGCAAGCACAGAAGTTATTTAGCTTTCC

ATAAGTATTTAGACTCAGAGTTACCTTTGAAGTTTCGTAAGTTTTATGTTGAATAAATATAAACAGAACGTGAATTTTTAGGCTTTGAATGTTAACTCAG

AGCTCAATCTAATTGAGTTATGTGCCATAAGGAAATCAGACCAGAGTCCAAGTTGTATGCAAACAAAAACCATCCCTATAATTTTATTCTCATAAGCATA

TTAATAAAGTGTAAATGGTGTTTTATATGATCTTTGAGATTCTCAAGTGCAATGTGTTTAAAATAAGCTTACAAAGGACTGCAGAACAACTTACTTCTGC

GTTAATTAACTTTATAGAAGTTGTGATTGTTTTGATGAATTAATGCTGTAGATTTAATTTATTTTTATATGGACTACATAATGTGTGCCTTTTAAAACAA

TAACAAAAACCAGAAATGTGCCTCTCTAGTTTGTGTTAATTAATGTGCCTCACTTTCTCCTCACTCTGGATCTTGTATTCAGATTCATACAGTGCTCAAG

CATATTTAAAAGATATTTGCAATTTTTAAAATACTTTTGGCTTGTAATTGAGAAGAAAATTCAAAATAACTAAAAGATAATTTATACTTAAAAATCCTGT

CTCATTTCTTTAGTGATGTACCGTAGCCACTAGAAAAACAAATCAGCCTAATGGAATATGTTTACTGGGAATAAAATTACCTTTAGATATTCAACATTGA

CCTCATTATAAATGCGTGAAGCAGACAAGCTCTGAAACTGTGGTGATAAATTGGTAACTGGTATTTTAACTGTAATTTAGCATTTCCCTTGACCCTACTT

ATCAAAGAGAATTTACACATTATTGTGTTGTAAACACAAGTTTCCTAGCATTTTATAAATAATTTTTTGAAAAGATTCATTTTAGCAGTGAGAGAAGTAC

TGTCACTTGTTTTATTTTAACAATTAGAAAGTTGTCAGATTCCCATATGGTAAAAATAGGTCAAGTATGTGAAGTGGTGAAGGATTGGATTAAGAGATTC

TGAAAATGAACTGTTCATACAGAGTAGTAGCTTTCTAGCAAATTCCGATTAACAAAAGAAATATATGTTTTAGACAAAGTTTCATAATTTACAAATGGGA

ATTTATGATAAATACCAACGTCTTTTTCATTTTTCATGGAAATGATAGCTTGTGTTATATCTGGTAAACCATTATATAAAACACTAATTTTGTTAATTTT

GTTAAGCTTTACAGAAAATAATATCCCTATTACTAGACATTAATATAACGTCTTGCTATACTAAACACAGCAGAAATCTATTCCTTTTCACAGTATGTAA

TACAAAATGAGCATTTTATAGTCAGTGTTACTCCAATTCTAAATTTAGGTTTGACTTAGGTAGACATAAGACAATTTGATCTTTACTAACTAGCAAAATT

AGAATTTCTAACTCTTATGTTCTTTAAAATGCCAGTTACAATTACACTTACTAAAATCTGACTAAATCTGCTTTTATTGGGCAGTTGATGCTTTAGTATT

TGAAGTTTGACACTGCTGCAATGTCTGTTTTTAATCAGGTGTTACCTTGAGATGTTAAACTGCTTGGAATGGTTAACCTTGTGCACTTTCTTAATCCCCA

TAGCCTTTATACTGAGTGTCAACATGCAAGTTTATATTGGGTACAGGTTACAATTTTAAAGCCATATGAGTTTATAGTGATTCTTTTTTCCATTTAAAAA

TTCACTAATGTTAAAAAAAATTTAAAAAAAGAGGCCCAGTAGATTCAGTGGGAGACTATCTTATCTAGCAAGCTGGTTCTTGCTTGTGTACAGTGATAAC

TTTGTAGCTGCTTCTTTAACTAAGAATTTGTAAACACAGAACTCTTAACACATGTGAGCTTTTAAGGATCGTTATTTACTACTTTGGGTTGTAATTAGAG

CACATCTATCTTCCAAAATTTTGTAAATATTTTTGATTTTTTTCATAACATGTAAATATTACATAAAAGTTGTATTCCTAATAAACATGTAATAT
Translation
EIMR RKGLTVQLWLSWNSICRPGCPQTQRDPPVSIFQVLGLK NIPDVDEEGFSIKPEANQND TKENHFYSSSDSDSEDEEPKRYRIEIKPAHPNNLH

HTMASLDELKVSIGNITLSPAVS RHSP VQMNRNSSN NEELTKSKPSSLPTE EKGTNDLLAWDPLFGSSLESSSAPLTSSSSA ARPTTPLSLGTLV

PPPRPASRPKLASGKLSGINEI PRPFSPPVTSNTSPPPTAPLARAESSSSISSSASLSAANTPTVG - UNI9558 - GVSRGPSPVSLGNQDTLPVA

IALTESVNAYFKGADPTK KCIVKITGDVTISFPSGIIKVFTSNPSPAVLCFRVKNISRLEQILPNSQLVFS SDPSQCDSNTKDFWMNMQAVTIYLKKL

SEQNPAASYYNVDVLKYQ VSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAPSVLSNIQVVVPVDGGVTNMQSLPPAIW WNAEQMKAFWKLS

GISEKSDSGG GSGSLRAKFDLSEGPSKPTTLAVQFLSEGNTLSGVDIELVGTGYRLSLVKKRFATG - UNI11816 - GRYLADC
Transcript ENSMUST00000040340
Sequence
CCCGGCGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAAGATGGTCATGGCGCATTTCGTGGAGAATTTCTGG - UNI4478 - - UNI16655 - GGG

GAAAAAAATAATGGCTTTGATGTACTGTACCATAATATGAAGCATGGACAGATATCAACTAAAGAACTAGCAGATTTTGTAAGAGAAAG AGCTACAATA

GAAGAGGCATACTCCAGATCAATGACAAAACTAGCGAAATCTGCAAGCAATTATTCACAACTTGG - UNI26247 - AACATTTGCACCAATGTGGGA

TGTATTCAAAACATCTACAGAGAAATTAGCAAATTGTCATTTGGATCTTGTTAGAAAATTACAGGAATTAATAAAGGAAGTTCAGAAGTATGGAGAGGAG

CAAGTCAAGTCTCATAAGAAG ACTAAAGAAGAAGTCGCAGGGACTCTGGAAGCAGTCCAAGCCATTCAGAATATAACTCAGGCACTCCAGAAGTCGAAG

GAAAATTACACTGCCAAATGTGTAGAACAGGAACGTCTGAAAAAGGAAGGAGCTACACAAAGAGAAATAGAAAAG GCAGCTGTTAAGTCTAAGAAAGCT

ACAGATACTTATAAACTTTATGTGGAAAAGTATGCATTAACAAAAGCAGATTTTGAGCAGAAGATGACAGAAACAGCCCAG AAATTTCAAGATATTGAA

GAAACTCACCTCATTCACATAAAGGAAATTATCGGATCCTTGTCAAATGCTGTCAAGGAGATCCACTTACAGATCGGCCAG GTTCATGAAGAGTTTATA

AATAACATGGCTAATACTACAATTGAAAGTTTGATTCAGAAATTTGCCGAGTCAAAAGGCACAGGGAAGGAAAGACCTG - UNI9698 - GTCTTATT

GAATTTGAAGAGTGTGACCCTGCTAGTGCAGTTGAAG - UNI20822 - GCATAAAACCAAGGAAAAGAAAGACTTTTGCTTTGCCTGGAATAATTAA

AAAGGAAAAGGACGCAGAATCTGT GGAATGTCCTGATGCAGATTCGCTT AATATTCCAGATGTAGATGAAGAAGGTTTCAGTATTAAACCAGAAGCAA

ATCAGAATGAT ACCAAAGAGAACCATTTCTACTCATCCAGTGACTCTGACTCTGAAGATGAAGAACCAAAGAGGTACCGGATAGAGATCAAGCCCGCGC

ATCCAAATAACTTGCATCACACAATGGCTTCTTTGGATGAACTGAAAGTATCCATAGGGAATATAACATTGTCCCCAGCAGTATCT AGACACAGTCCA 

GTGCAGATGAATCGGAATTCATCTA ATGAAGAATTAACAAAATCAAAGCCGTCTTCTCTACCCACTGA GAAAGGGACCAATGATTTACTTGCTTGGGA

TCCCCTGTTCGGATCGTCGCTTGAGTCATCTTCAGCTCCACTAACTTCGTCATCATCGG CCAGACCCACGACACCTCTCTCTTTAGGCACCCTTGTTCC

ACCTCCAAGGCCTGCTTCCAGACCAAAGCTTGCTTCAGGAAAACTGAGTGGGATCAATGAAATA CCCAGGCCATTCAGCCCACCTGTAACTTCCAACAC

CAGCCCACCTCCTACTGCTCCCTTAGCCCGAGCCGAGAGCAGCTCCTCTATCTCCTCGTCTGCCTCGTTGAGTGCTGCCAACACTCCAACAGTAG - UN

I9558 - GTGTATCACGGGGTCCCAGCCCGGTCAGCCTTGGAAACCAGGACACTTTACCTGTGGCAATCGCCCTTACAGAATCTGTCAACGCCTACTTT

AAAGGAGCAGATCCTACCAA GTGTATTGTGAAGATCACGGGAGACGTGACAATATCATTTCCCAGTGGGATTATTAAAGTCTTCACCAGCAACCCCTCC

CCAGCTGTGCTGTGCTTTAGGGTGAAGAACATCAGCAGGCTGGAGCAGATCCTTCCAAACTCCCAGCTTGTGTTCAG TGATCCATCACAGTGTGATTCC

AACACAAAAGATTTTTGGATGAACATGCAAGCTGTTACTATCTACCTCAAGAAGCTATCAGAACAAAATCCAGCTGCTTCTTATTATAATGTAGATGTAT

TAAAATACCAG GTATCATCAAATGGCATTCAGTCCACTCCTCTAAATCTTGCAACCTACTGGAAATGTAGTGCCAGCACCACAGATCTGAGAGTGGATT

ATAAGTACAACCCAGAAGCTATGGTCGCTCCGAGTGTGCTTTCCAACATACAGGTGGTGGTTCCCGTGGATGGAGGTGTCACAAATATGCAGTCCCTTCC

TCCTGCAATATG GAATGCAGAGCAAATGAAAGCTTTTTGGAAATTATCTGGGATTTCGGAGAAATCAGACAGTGGAG GTTCTGGATCCCTCAGAGCAA

AATTTGATCTTTCAGAAGGACCCAGCAAACCTACAACACTGGCAGTGCAATTCCTCAGTGAGGGCAATACGCTCTCAGGAGTGGATATTGAGCTTGTGGG

TACTGGCTATAGACTTTCCTTAGTAAAGAAGCGCTTTGCCACTG - UNI11816 - GACGATACTTGGCAGATTGTTGATGGACCCCGAATGCGGTTT

TCTCAAGGGAATAGTGTGCACCTGCCACTCTGCCTCGCCTGTTCCTTCCAAACACTATTTTTACTTGTATGATGTCTTTCAAATTTGCTCTTTGAAAGCT

GACTACAAACATTAACTTGCACTTTCAAAGTGTCATTGAAAGAAATAGCACTGAAATGACCTTGTACACAGTAAATGATCAAATGCAATATTCTGGAAGC

ACATTAATTCAAATTGTCACTAAAATGAAGTCTATTATCTTCAGTGTCTGTGTTCTTAAAAAGGTTAGAATGTAGTAACAAGCCTAACATTTCAGGAGAG

CAAGCACAGAAGTTATTTAGCTTTCCATAAGTATTTAGACTCAGAGTTACCTTTGAAGTTTCGTAAGTTTTATGTTGAATAAATATAAACAGAACGTGAA

TTTTTAGGCTTTGAATGTTAACTCAGAGCTCAATCTAATTGAGTTATGTGCCATAAGGAAATCAGACCAGAGTCCAAGTTGTATGCAAACAAAAACCATC

CCTATAATTTTATTCTCATAAGCATATTAATAAAGTGTAAATGGTGTTTTATATGATCTTTGAGATTCTCAAGTGCAATGTGTTTAAAATAAGCTTACAA

AGGACTGCAGAACAACTTACTTCTGCGTTAATTAACTTTATAGAAGTTGTGATTGTTTTGATGAATTAATGCTGTAGATTTAATTTATTTTTATATGGAC

TACATAATGTGTGCCTTTTAAAACAATAACAAAAACCAGAAATGTGCCTCTCTAGTTTGTGTTAATTAATGTGCCTCACTTTCTCCTCACTCTGGATCTT

GTATTCAGATTCATACAGTGCTCAAGCATATTTAAAAGATATTTGCAATTTTTAAAATACTTTTGGCTTGTAATTGAGAAGAAAATTCAAAATAACTAAA

AGATAATTTATACTTAAAAATCCTGTCTCATTTCTTTAGTGATGTACCGTAGCCACTAGAAAAACAAATCAGCCTAATGGAATATGTTTACTGGGAATAA

AATTACCTTTAGATATTCAACATTGACCTCATTATAAATGCGTGAAGCAGACAAGCTCTGAAACTGTGGTGATAAATTGGTAACTGGTATTTTAACTGTA

ATTTAGCATTTCCCTTGACCCTACTTATCAAAGAGAATTTACACATTATTGTGTTGTAAACACAAGTTTCCTAGCATTTTATAAATAATTTTTTGAAAAG

ATTCATTTTAGCAGTGAGAGAAGTACTGTCACTTGTTTTATTTTAACAATTAGAAAGTTGTCAGATTCCCATATGGTAAAAATAGGTCAAGTATGTGAAG

TGGTGAAGGATTGGATTAAGAGATTCTGAAAATGAACTGTTCATACAGAGTAGTAGCTTTCTAGCAAATTCCGATTAACAAAAGAAATATATGTTTTAGA

CAAAGTTTCATAATTTACAAATGGGAATTTATGATAAATACCAACGTCTTTTTCATTTTTCATGGAAATGATAGCTTGTGTTATATCTGGTAAACCATTA

TATAAAACACTAATTTTGTTAATTTTGTTAAGCTTTACAGAAAATAATATCCCTATTACTAGACATTAATATAACGTCTTGCTATACTAAACACAGCAGA

AATCTATTCCTTTTCACAGTATGTAATACAAAATGAGCATTTTATAGTCAGTGTTACTCCAATTCTAAATTTAGGTTTGACTTAGGTAGACATAAGACAA

TTTGATCTTTACTAACTAGCAAAATTAGAATTTCTAACTCTTATGTTCTTTAAAATGCCAGTTACAATTACACTTACTAAAATCTGACTAAATCTGCTTT

TATTGGGCAGTTGATGCTTTAGTATTTGAAGTTTGACACTGCTGCAATGTCTGTTTTTAATCAGGTGTTACCTTGAGATGTTAAACTGCTTGGAATGGTT

AACCTTGTGCACTTTCTTAATCCCCATAGCCTTTATACTGAGTGTCAACATGCAAGTTTATATTGGGTACAGGTTACAATTTTAAAGCCATATGAGTTTA

TAGTGATTCTTTTTTCCATTTAAAAATTCACTAATGTTAAAAAAAATTTAAAAAAAGAGGCCCAGTAGATTCAGTGGGAGACTATCTTATCTAGCAAGCT

GGTTCTTGCTTGTGTACAGTGATAACTTTGTAGCTGCTTCTTTAACTAAGAATTTGTAAACACAGAACTCTTAACACATGTGAGCTTTTAAGGATCGTTA

TTTACTACTTTGGGTTGTAATTAGAGCACATCTATCTTCCAAAATTTTGTAAATATTTTTGATTTTTTTCATAACATGTAAATATTACATAAAAGTTGTA

TTCCTAATAAACATGTAATAT
Translation
 - UNI4478 - - UNI16655 - MKHGQISTKELADFVRER RATIEEAYSRSMTKLAKSASNYSQLG - UNI26247 - GTFAPMWDVFKTSTE

KLANCHLDLVRKLQELIKEVQKYGEEQVKSHKK TKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKKEGATQREIEK AAVKSKKATDTYKL

YVEKYALTKADFEQKMTETAQ KFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQ VHEEFINNMANTTIESLIQKFAESKGTGKERPG - UNI9698 

- GLIEFEECDPASAVEG - UNI20822 - GIKPRKRKTFALPGIIKKEKDAESV VECPDADSL NIPDVDEEGFSIKPEANQND TKENHFYSSSD

SDSEDEEPKRYRIEIKPAHPNNLHHTMASLDELKVSIGNITLSPAVS RHSP VQMNRNSSN NEELTKSKPSSLPTE EKGTNDLLAWDPLFGSSLESS

SAPLTSSSSA ARPTTPLSLGTLVPPPRPASRPKLASGKLSGINEI PRPFSPPVTSNTSPPPTAPLARAESSSSISSSASLSAANTPTVG - UNI955

8 - GVSRGPSPVSLGNQDTLPVAIALTESVNAYFKGADPTK KCIVKITGDVTISFPSGIIKVFTSNPSPAVLCFRVKNISRLEQILPNSQLVFS SDP

SQCDSNTKDFWMNMQAVTIYLKKLSEQNPAASYYNVDVLKYQ VSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAPSVLSNIQVVVPVDGGVT

NMQSLPPAIW WNAEQMKAFWKLSGISEKSDSGG GSGSLRAKFDLSEGPSKPTTLAVQFLSEGNTLSGVDIELVGTGYRLSLVKKRFATG - UNI118

16 - GRYLADC

For any suggestions or comments, please send an email to unitrap@crg.es